DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GlcAT-I and B3GAT1

DIOPT Version :9

Sequence 1:NP_726910.1 Gene:GlcAT-I / 251900 FlyBaseID:FBgn0066114 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001354902.1 Gene:B3GAT1 / 27087 HGNCID:921 Length:347 Species:Homo sapiens


Alignment Length:346 Identity:144/346 - (41%)
Similarity:190/346 - (54%) Gaps:60/346 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PRQVLILIIVFLVV----------------LMMVHRN-----GKRTCQGP-------------EY 38
            |::..||.||.:|:                |:.||::     .:.|..|.             |.
Human    15 PKRRDILAIVLIVLPWTLLITVWHQSTLAPLLAVHKDEGSDPRRETPPGADPREYCTSDRDIVEV 79

  Fly    39 LQAMFVQ------GDTLPTIYAVTPTYPRPAQKAELTRLSHLFMLLPHLHWIIVEDTNATTPLVR 97
            ::..:|.      .||||||:.|||||.||.|||||||:::..:.:|:|||::|||....|||..
Human    80 VRTEYVYTRPPPWSDTLPTIHVVTPTYSRPVQKAELTRMANTLLHVPNLHWLVVEDAPRRTPLTA 144

  Fly    98 NLLDRAGLEKRSTLLNIKTPSEFKLKG--KDPNWIKPRGVEQRNLALAWLRNHVDVDRHS----I 156
            .||...||  ..|.|:::||..:||:|  :||.  .|||..||||||.|||.  ...|:|    :
Human   145 RLLRDTGL--NYTHLHVETPRNYKLRGDARDPR--IPRGTMQRNLALRWLRE--TFPRNSSQPGV 203

  Fly   157 VFFMDDDNSYSTELFAEMSKIERGRVGVWPVGLVGGLMVERPLLTEDGTKVTGFNAAWRPERPFP 221
            |:|.||||:||.|||.||....  ||.||||..||||..|.|.:...| ||.|:...:.|.|||.
Human   204 VYFADDDNTYSLELFEEMRSTR--RVSVWPVAFVGGLRYEAPRVNGAG-KVVGWKTVFDPHRPFA 265

  Fly   222 IDMAAFAISMDLFIRNPQATFSYE-VQRGYQESEILRHLTTRDQLQPLANRCTDVLVWHTRTEKT 285
            ||||.||:::.|.::..||.|... |:.|||||.:||.|.|.:.|:|.|..||.:|||||||||.
Human   266 IDMAGFAVNLRLILQRSQAYFKLRGVKGGYQESSLLRELVTLNDLEPKAANCTKILVWHTRTEKP 330

  Fly   286 KLAAEEALLKKGQRSDGGMEV 306
            .|..|.   ||| .:|..:|:
Human   331 VLVNEG---KKG-FTDPSVEI 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GlcAT-INP_726910.1 GlcAT-I 50..284 CDD:132995 119/240 (50%)
B3GAT1NP_001354902.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 195 1.000 Domainoid score I3154
eggNOG 1 0.900 - - E1_KOG1476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52067
OrthoDB 1 1.010 - - D385244at33208
OrthoFinder 1 1.000 - - FOG0000504
OrthoInspector 1 1.000 - - otm41931
orthoMCL 1 0.900 - - OOG6_101385
Panther 1 1.100 - - O PTHR10896
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X314
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.790

Return to query results.
Submit another query.