DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GlcAT-I and B3GAT2

DIOPT Version :9

Sequence 1:NP_726910.1 Gene:GlcAT-I / 251900 FlyBaseID:FBgn0066114 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_542780.1 Gene:B3GAT2 / 135152 HGNCID:922 Length:323 Species:Homo sapiens


Alignment Length:272 Identity:136/272 - (50%)
Similarity:164/272 - (60%) Gaps:34/272 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RNGKRTCQGPEYLQAMFVQGDTLPTIYAVTPTYPRPAQKAELTRLSHLFMLLPHLHWIIVEDTNA 91
            ||..|....||         ..||||||:||||.||.||||||||::.|..:..||||:|||..|
Human    66 RNQSRPQPQPE---------PQLPTIYAITPTYSRPVQKAELTRLANTFRQVAQLHWILVEDAAA 121

  Fly    92 TTPLVRNLLDRAGLEKRSTLLNIKTPSEFKLKGKDPNWIKPRGVEQRNLALAWLRNHVDVDRH-- 154
            .:.||...|.||||.  ||.|::.||..:|..|      .||..||||..|||||     .||  
Human   122 RSELVSRFLARAGLP--STHLHVPTPRRYKRPG------LPRATEQRNAGLAWLR-----QRHQH 173

  Fly   155 -----SIVFFMDDDNSYSTELFAEMSKIERGRVGVWPVGLVGGLMVERPLLTEDGTKVTGFNAAW 214
                 .::||.||||:||.|||.||....  :|.|||||||||...||||: |:| ||.|:...|
Human   174 QRAQPGVLFFADDDNTYSLELFQEMRTTR--KVSVWPVGLVGGRRYERPLV-ENG-KVVGWYTGW 234

  Fly   215 RPERPFPIDMAAFAISMDLFIRNPQATFSYE-VQRGYQESEILRHLTTRDQLQPLANRCTDVLVW 278
            |.:|||.||||.||:|:.:.:.||:|.|... .|.|.|||:.|:.:||.::|:|.||.||.||||
Human   235 RADRPFAIDMAGFAVSLQVILSNPKAVFKRRGSQPGMQESDFLKQITTVEELEPKANNCTKVLVW 299

  Fly   279 HTRTEKTKLAAE 290
            ||||||..||.|
Human   300 HTRTEKVNLANE 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GlcAT-INP_726910.1 GlcAT-I 50..284 CDD:132995 125/241 (52%)
B3GAT2NP_542780.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 51..80 5/22 (23%)
GlcAT-I 81..305 CDD:132995 124/240 (52%)
Interaction with galactose moiety of substrate glycoprotein. /evidence=ECO:0000250 234..243 5/8 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52067
OrthoDB 1 1.010 - - D385244at33208
OrthoFinder 1 1.000 - - FOG0000504
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101385
Panther 1 1.100 - - O PTHR10896
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X314
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.790

Return to query results.
Submit another query.