DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GlcAT-I and b3gat1b

DIOPT Version :9

Sequence 1:NP_726910.1 Gene:GlcAT-I / 251900 FlyBaseID:FBgn0066114 Length:306 Species:Drosophila melanogaster
Sequence 2:XP_002663665.1 Gene:b3gat1b / 100332644 ZFINID:ZDB-GENE-131101-1 Length:336 Species:Danio rerio


Alignment Length:264 Identity:125/264 - (47%)
Similarity:168/264 - (63%) Gaps:13/264 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 DTLPTIYAVTPTYPRPAQKAELTRLSHLFMLLPHLHWIIVEDTNATTPLVRNLLDRAGLEKRSTL 111
            :.|||::.:||||.||.||||||||::..:.:|:|||::|||:...||||..||:.:.|  ..|.
Zfish    82 NALPTLHIITPTYSRPVQKAELTRLANTLLHVPNLHWLLVEDSAQKTPLVSRLLENSRL--NYTH 144

  Fly   112 LNIKTPSEFKL-KGKDPNWIKPRGVEQRNLALAWLRNHVD--VDRHSIVFFMDDDNSYSTELFAE 173
            ||::||...|: :.|..|...|||..||||||.|||.::.  :.:..:|:|.||||:||.|||.|
Zfish   145 LNVETPPNLKVQRTKFRNARIPRGTMQRNLALRWLRANIGPRLGQSGVVYFADDDNTYSLELFEE 209

  Fly   174 MSKIERGRVGVWPVGLVGGLMVERPLLTEDGTKVTGFNAAWRPERPFPIDMAAFAISMDLFIRNP 238
            |....  :..||||..||||..|.|.:...| ||:|:...:.|.|||.||||.||:::.|.:..|
Zfish   210 MRWTH--KASVWPVAFVGGLRYESPKINSQG-KVSGWRTVFDPRRPFAIDMAGFAVNLQLILSKP 271

  Fly   239 QATFSYE-VQRGYQESEILRHLTTRDQLQPLANRCTDVLVWHTRTEKTKLAAEEALLKKGQRSDG 302
            ||.|..: |:.|||||.:|:.|.|...|:|.|:.||.|||||||||:..|..|.   ||| .:||
Zfish   272 QAYFKLKGVKGGYQESSLLQDLVTLSDLEPKADNCTKVLVWHTRTERPLLVNEG---KKG-FTDG 332

  Fly   303 GMEV 306
            .:||
Zfish   333 RVEV 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GlcAT-INP_726910.1 GlcAT-I 50..284 CDD:132995 114/237 (48%)
b3gat1bXP_002663665.1 Glyco_transf_43 106..315 CDD:281369 96/213 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52067
OrthoDB 1 1.010 - - D385244at33208
OrthoFinder 1 1.000 - - FOG0000504
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101385
Panther 1 1.100 - - O PTHR10896
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X314
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.