DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idh3g and Idh3b

DIOPT Version :9

Sequence 1:XP_006229613.1 Gene:Idh3g / 25179 RGDID:2863 Length:395 Species:Rattus norvegicus
Sequence 2:NP_001163682.1 Gene:Idh3b / 42586 FlyBaseID:FBgn0038922 Length:370 Species:Drosophila melanogaster


Alignment Length:349 Identity:184/349 - (52%)
Similarity:239/349 - (68%) Gaps:25/349 - (7%)


- Green bases have known domain annotations that are detailed below.


  Rat    53 YG-GRHTVTMIPGDGIGPELMLHVKSVFRHACVPVDFE-----EVHVSSNADEEDIRNAIMAIRR 111
            || .|.|.|:|||||:||||:..::.||:.|.||||||     |::...:|..||:   :.:|::
  Fly    33 YGANRTTCTLIPGDGVGPELVYSLQEVFKAASVPVDFECYFLSEINPVLSAKLEDV---VASIQK 94

  Rat   112 NRVALKGNIETNHNLPPSH------KSRNNILRTSLDLYANVIHCKSLPGVVTRHKDIDILIVRE 170
            |:|.:||.:.|     |.:      ::.|..||..|||||||:|.:|||||.|||.:||.:|:||
  Fly    95 NKVCIKGVLAT-----PDYSNVGDLQTLNMKLRNDLDLYANVVHVRSLPGVKTRHTNIDTVIIRE 154

  Rat   171 NTEGEYSSLEHESVAGVVESLKIITKAKSLRIAEYAFKLAQESGRKKVTAVHKANIMKLGDGLFL 235
            .||||||:||||||.|:||.|||||..||:|||::||..|.::.|||||||||||||||||||||
  Fly   155 QTEGEYSALEHESVPGIVECLKIITAKKSMRIAKFAFDYATKNQRKKVTAVHKANIMKLGDGLFL 219

  Rat   236 QCCREVAARYPQITFDSMIVDNTTMQLVSRPQQFDVMVMPNLYGNIVNNVCAGLVGGPGLVAGAN 300
            :.|.||:..||:|.|:.|||||||||:||.|.||||||.|||||.||:|:.:|||||.|:||||:
  Fly   220 RSCEEVSRLYPRIQFEKMIVDNTTMQMVSNPNQFDVMVTPNLYGAIVDNLASGLVGGAGVVAGAS 284

  Rat   301 YGHVYAVFETATRNTGKSIANKNIANPTATLLASCMMLDHLKLHSYATSIRKAVLASMDNENMHT 365
            |.....|||...|:|......||:|||||.||....:|.|:.|.:|...|:.|:...:::..:.|
  Fly   285 YSSESVVFEPGARHTFAEAVGKNVANPTAMLLCGVKLLRHINLPTYGEIIQNAINKVLNDGKVRT 349

  Rat   366 PDIGGQGTTSQAIQDIIRHIRIIN 389
            .|:|||.||    ||..|.| |:|
  Fly   350 KDLGGQSTT----QDFTRAI-ILN 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idh3gXP_006229613.1 mito_nad_idh 54..385 CDD:272942 180/342 (53%)
Idh3bNP_001163682.1 Iso_dh 37..369 CDD:294303 182/345 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53770
OrthoDB 1 1.010 - - D325037at33208
OrthoFinder 1 1.000 - - FOG0000244
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101342
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.