DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32147 and AT1G56700

DIOPT Version :9

Sequence 1:NP_730035.1 Gene:CG32147 / 251690 FlyBaseID:FBgn0047178 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001077729.1 Gene:AT1G56700 / 842126 AraportID:AT1G56700 Length:219 Species:Arabidopsis thaliana


Alignment Length:228 Identity:61/228 - (26%)
Similarity:94/228 - (41%) Gaps:46/228 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IVVSGFGPFLGHEAVNASWEAVKLLPEILTHDGIEYDLEKRLVSVEYGAVDEAVAEIWKRQPYLV 73
            |.::||..|.| .|.|.:.:....|.|.|..:.:..|:.....:|...|...|:|.:::.....|
plant    11 IHITGFKKFHG-VAENPTEKMANNLKEYLAKNCVSKDVNLGSCTVLETAGQGALASLYQLLQSAV 74

  Fly    74 --------------IHVGVSGVAKCVYIEKLAYNH-KFRRADNCDKKLANGTCELPNNGH-ANVL 122
                          :|.||:..|....||:.|.|. .||..|....|..|... :|::|. :.|.
plant    75 NTKESESLTGKTIWVHFGVNSGATKFAIEQQAVNEATFRCPDELGWKPQNLPI-VPSDGPISTVR 138

  Fly   123 KTELDVDKIVAVVNENCADCVGPTQQPTHNDNLKSLSATKASKNVGDFLCGYIYLKSL---DMDR 184
            ||.|.|::|...:.:|..:.:                   .|.:.|.|:|.|:|..||   :.::
plant   139 KTNLPVEEITKALEKNGFEVI-------------------TSDDAGRFVCNYVYYHSLRFAEQNK 184

  Fly   185 KRSLFVHVP---PVDRPFS---SVKTSEILFSI 211
            .||||||||   .||....   :|...|:|.||
plant   185 TRSLFVHVPLFVAVDEETQMRFTVSLLEVLASI 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32147NP_730035.1 Peptidase_C15 7..222 CDD:238279 61/228 (27%)
AT1G56700NP_001077729.1 Peptidase_C15 9..216 CDD:238279 59/225 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2039
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I2689
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1248044at2759
OrthoFinder 1 1.000 - - FOG0002733
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101530
Panther 1 1.100 - - LDO PTHR23402
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2169
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.830

Return to query results.
Submit another query.