DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32147 and Pgpep1l

DIOPT Version :9

Sequence 1:NP_730035.1 Gene:CG32147 / 251690 FlyBaseID:FBgn0047178 Length:224 Species:Drosophila melanogaster
Sequence 2:XP_017167887.1 Gene:Pgpep1l / 78444 MGIID:1925694 Length:224 Species:Mus musculus


Alignment Length:170 Identity:52/170 - (30%)
Similarity:80/170 - (47%) Gaps:33/170 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SDRKLIVVSGFGPFLGHEAVNASWEAVK------LLPEILTHD-------GIEYDLEKRLVS--V 53
            |..:.:||:|||||..| .||:||||||      .:|...:.:       |::.|:|.|.:.  |
Mouse     3 SQSRCVVVTGFGPFRQH-LVNSSWEAVKRAWLGACVPGTESFEELSKLGLGVDTDIELRTLQLPV 66

  Fly    54 EYGAVDEAVAEIWKR-QPYLVIHVGVSGVAKCVYIEKLAYNHKFRRADNCDKKLANGTCELPNNG 117
            :|..|...:..||:. ||.||:|||:...||.:::|:...|..:|.:|....:..:|.| ||...
Mouse    67 DYREVKRRLTTIWEDFQPQLVVHVGMDSSAKAIFLEQCGKNRGYRDSDVRGFQPEDGVC-LPGGP 130

  Fly   118 HANVLKTEL-DVDKIVAVVNEN--------------CADC 142
            ...:....: :|.:.|||.|..              ||.|
Mouse   131 EVRLSVVNMKEVCRRVAVENVEVAFSRDAGRYFRTPCAKC 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32147NP_730035.1 Peptidase_C15 7..222 CDD:238279 51/167 (31%)
Pgpep1lXP_017167887.1 Peptidase_C15 6..>162 CDD:381888 48/157 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831436
Domainoid 1 1.000 76 1.000 Domainoid score I8930
eggNOG 1 0.900 - - E1_COG2039
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002733
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101530
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.600

Return to query results.
Submit another query.