DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32147 and pgpep1

DIOPT Version :9

Sequence 1:NP_730035.1 Gene:CG32147 / 251690 FlyBaseID:FBgn0047178 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001018362.1 Gene:pgpep1 / 553547 ZFINID:ZDB-GENE-050522-88 Length:208 Species:Danio rerio


Alignment Length:215 Identity:73/215 - (33%)
Similarity:111/215 - (51%) Gaps:24/215 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RKLIVVSGFGPFLGHEAVNASWEAVKLLPEILTHDGIEYDLEKRLVSVEYGAVDEAVAEIWK-RQ 69
            ||.:||:||.|| |...|||||.||:.|.::...|.|  :|....|.|||.||...:..:|| ..
Zfish     4 RKTVVVTGFEPF-GEHTVNASWVAVQELEKLGLGDDI--NLHVAEVPVEYQAVQNLLPSLWKDHL 65

  Fly    70 PYLVIHVGVSGVAKCVYIEKLAYNHKFRRADNCDKKLANGTCELPNNGHANVLKTELDVDKIVAV 134
            |.||:||||||:|..|.:|:..:|..:.|.|||.....:..|.   :|..:.:.:.:|:|.:...
Zfish    66 PQLVVHVGVSGMATTVTLEQCGHNQGYMRMDNCMFCPVSRCCV---DGGPDCIHSVIDMDMVCKR 127

  Fly   135 VNENCADCVGPTQQPTHNDNLKSLSATKASKNVGDFLCGYIYLKSLDMDRKRSLFVHVPPVDRPF 199
            ||.:....                 :...||:.|.:||.|.|..||.:...||.||||||:|:|:
Zfish   128 VNSSGLGV-----------------SVSVSKDAGRYLCDYTYYMSLFVGEGRSAFVHVPPLDKPY 175

  Fly   200 SSVKTSEILFSIVEQCIQQV 219
            |:...:..|.:|:.:.::.:
Zfish   176 SAEDLARALRAIIREMLEHM 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32147NP_730035.1 Peptidase_C15 7..222 CDD:238279 72/214 (34%)
pgpep1NP_001018362.1 Peptidase_C15 5..192 CDD:238279 72/209 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574448
Domainoid 1 1.000 75 1.000 Domainoid score I9018
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9793
Inparanoid 1 1.050 112 1.000 Inparanoid score I4838
OMA 1 1.010 - - QHG52915
OrthoDB 1 1.010 - - D1248044at2759
OrthoFinder 1 1.000 - - FOG0002733
OrthoInspector 1 1.000 - - oto38746
orthoMCL 1 0.900 - - OOG6_101530
Panther 1 1.100 - - LDO PTHR23402
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3612
SonicParanoid 1 1.000 - - X2169
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1413.940

Return to query results.
Submit another query.