DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32147 and PGPEP1

DIOPT Version :9

Sequence 1:NP_730035.1 Gene:CG32147 / 251690 FlyBaseID:FBgn0047178 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001316400.1 Gene:PGPEP1 / 54858 HGNCID:13568 Length:209 Species:Homo sapiens


Alignment Length:98 Identity:44/98 - (44%)
Similarity:59/98 - (60%) Gaps:4/98 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RKLIVVSGFGPFLGHEAVNASWEAVKLLPEILTHDGIEYDLEKRLVSVEYGAVDEAVAEIW-KRQ 69
            ||.:||:||||| |...|||||.||:.|.::...|.:  ||....:.|||..|...:..:| |..
Human     5 RKAVVVTGFGPF-GEHTVNASWIAVQELEKLGLGDSV--DLHVYEIPVEYQTVQRLIPALWEKHS 66

  Fly    70 PYLVIHVGVSGVAKCVYIEKLAYNHKFRRADNC 102
            |.||:||||||:|..|.:||..:|..::..|||
Human    67 PQLVVHVGVSGMATTVTLEKCGHNKGYKGLDNC 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32147NP_730035.1 Peptidase_C15 7..222 CDD:238279 43/97 (44%)
PGPEP1NP_001316400.1 Peptidase_C15 6..>146 CDD:238279 43/97 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141481
Domainoid 1 1.000 76 1.000 Domainoid score I8971
eggNOG 1 0.900 - - E1_COG2039
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9793
Inparanoid 1 1.050 106 1.000 Inparanoid score I4939
Isobase 1 0.950 - 1 Normalized mean entropy S5086
OMA 1 1.010 - - QHG52915
OrthoDB 1 1.010 - - D1248044at2759
OrthoFinder 1 1.000 - - FOG0002733
OrthoInspector 1 1.000 - - otm41417
orthoMCL 1 0.900 - - OOG6_101530
Panther 1 1.100 - - LDO PTHR23402
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3612
SonicParanoid 1 1.000 - - X2169
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.750

Return to query results.
Submit another query.