DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32147 and pgpep1

DIOPT Version :9

Sequence 1:NP_730035.1 Gene:CG32147 / 251690 FlyBaseID:FBgn0047178 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001006752.1 Gene:pgpep1 / 448426 XenbaseID:XB-GENE-961493 Length:208 Species:Xenopus tropicalis


Alignment Length:207 Identity:68/207 - (32%)
Similarity:109/207 - (52%) Gaps:26/207 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IVVSGFGPFLGHEAVNASWEAVKLLPEILTHDGIEYDLEKRLVSVEYGAVDEAVAEIWKR-QPYL 72
            :||:||||| |...|||||.||:.|.::..  |.|.||....:.|||..|...:..:.|: :|.:
 Frog     8 VVVTGFGPF-GEHTVNASWVAVQELGKLGL--GKEVDLHIYEIPVEYQTVQRLIPALRKKHKPKV 69

  Fly    73 VIHVGVSGVAKCVYIEKLAYNHKFRRADNCDKKLANGT-CELPNNGHANVLKTELDVDKIVAVVN 136
            ::||||||:|..|.:||..:|..::..|||:  ...|| |.:  .|....|.:.:|:|.:.....
 Frog    70 IVHVGVSGMATAVTLEKCGHNTGYQGLDNCE--FCPGTQCCV--EGGPECLHSVIDIDTVCKRAA 130

  Fly   137 ENCADCVGPTQQPTHNDNLKSLSATKASKNVGDFLCGYIYLKSLDMDRKRSLFVHVPPVDRPFSS 201
            |.|.|.     |.|            .|.:.|.:||.:.|..||.....||:|:||||:.:|:::
 Frog   131 EACLDV-----QFT------------VSTDAGRYLCDFTYYTSLYQSHGRSVFIHVPPLGKPYTA 178

  Fly   202 VKTSEILFSIVE 213
            ::..:.:.:|::
 Frog   179 IQLGQAIQTIIK 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32147NP_730035.1 Peptidase_C15 7..222 CDD:238279 68/207 (33%)
pgpep1NP_001006752.1 Peptidase_C15 6..199 CDD:238279 68/207 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 72 1.000 Domainoid score I9180
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9793
Inparanoid 1 1.050 103 1.000 Inparanoid score I4828
OMA 1 1.010 - - QHG52915
OrthoDB 1 1.010 - - D1248044at2759
OrthoFinder 1 1.000 - - FOG0002733
OrthoInspector 1 1.000 - - otm48624
Panther 1 1.100 - - LDO PTHR23402
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3612
SonicParanoid 1 1.000 - - X2169
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.