DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32147 and Pgpep1l

DIOPT Version :9

Sequence 1:NP_730035.1 Gene:CG32147 / 251690 FlyBaseID:FBgn0047178 Length:224 Species:Drosophila melanogaster
Sequence 2:XP_038956931.1 Gene:Pgpep1l / 365280 RGDID:1561859 Length:204 Species:Rattus norvegicus


Alignment Length:219 Identity:60/219 - (27%)
Similarity:107/219 - (48%) Gaps:32/219 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SDRKLIVVSGFGPFLGHEAVNASWEAVKLLPEILTHDGIEYDLEKRLVSVEYGAVDEAVAEIWKR 68
            |..:.:||:|||||..| .||:||||||.|.::..  |::.:|:...:.|:|..|.:.:..||:.
  Rat     3 SQSRCVVVTGFGPFRQH-LVNSSWEAVKELSKLGL--GVDIELQTLQLPVDYREVKQRLTAIWEE 64

  Fly    69 -QPYLVIHVGVSGVAKCVYIEKLAYNHKFRRADNCDKKLANGTCELPNNGHANVLKTELDVDKI- 131
             ||.|.:|||:....|.:::|:...|..:|.:|....:..:|.| ||  |...|:.:.:::.:: 
  Rat    65 FQPQLAVHVGMDTSTKAIFLEQCGKNRGYRDSDVRGFQPEDGVC-LP--GGPEVMLSVINMKEVC 126

  Fly   132 --VAVVNENCADCVGPTQQPTHNDNLKSLSATKASKNVGDFLCGYIYLKSLDMDRKRSLFVHVPP 194
              |||.:...|                      .|.:.|.::|.|.|..||.:....:..:||||
  Rat   127 RRVAVEDVEVA----------------------FSXDAGRYICDYTYYLSLHLGTGHAALIHVPP 169

  Fly   195 VDRPFSSVKTSEILFSIVEQCIQQ 218
            :....|.....:.|..|:::.:::
  Rat   170 LSPCLSVSLLGKALQVIIQEMLEE 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32147NP_730035.1 Peptidase_C15 7..222 CDD:238279 59/216 (27%)
Pgpep1lXP_038956931.1 Peptidase_C15 6..191 CDD:238279 59/212 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1248044at2759
OrthoFinder 1 1.000 - - FOG0002733
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101530
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.