DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32147 and Pgpep1

DIOPT Version :9

Sequence 1:NP_730035.1 Gene:CG32147 / 251690 FlyBaseID:FBgn0047178 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_973717.1 Gene:Pgpep1 / 290648 RGDID:1303133 Length:209 Species:Rattus norvegicus


Alignment Length:212 Identity:73/212 - (34%)
Similarity:112/212 - (52%) Gaps:24/212 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RKLIVVSGFGPFLGHEAVNASWEAVKLLPEILTHDGIEYDLEKRLVSVEYGAVDEAVAEIW-KRQ 69
            ||.:||:||||| |..||||||.||:.|.::...|.:  ||....:.|||..|...:..:| |..
  Rat     5 RKAVVVTGFGPF-GEHAVNASWIAVQELEKLGLGDSV--DLHVYEIPVEYQTVQRLIPALWEKHS 66

  Fly    70 PYLVIHVGVSGVAKCVYIEKLAYNHKFRRADNCDKKLANGTCELPNNGHANVLKTELDVDKIVAV 134
            |.||:||||||:|..|.:||..:|..::..|||  :...|:.....:|..:: .:.:|:|.:...
  Rat    67 PQLVVHVGVSGMATTVTLEKCGHNKGYKGLDNC--RFCPGSQCCVEDGPESI-DSIIDMDAVCKR 128

  Fly   135 VNENCADCVGPTQQPTHNDNLKSLSATKASKNVGDFLCGYIYLKSLDMDRKRSLFVHVPPVDRPF 199
            |.....|                :|.| .|::.|.:||.:.|..||...|.||.||||||:.:|:
  Rat   129 VTTLGLD----------------VSVT-ISQDAGRYLCDFTYYTSLYRGRGRSAFVHVPPLGKPY 176

  Fly   200 SSVKTSEILFSIVEQCI 216
            ::.:....|.:|:|:.:
  Rat   177 NADQLGRALRAIIEEML 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32147NP_730035.1 Peptidase_C15 7..222 CDD:238279 72/211 (34%)
Pgpep1NP_973717.1 Peptidase_C15 6..199 CDD:238279 72/211 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335172
Domainoid 1 1.000 78 1.000 Domainoid score I8600
eggNOG 1 0.900 - - E1_COG2039
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9793
Inparanoid 1 1.050 108 1.000 Inparanoid score I4822
OMA 1 1.010 - - QHG52915
OrthoDB 1 1.010 - - D1248044at2759
OrthoFinder 1 1.000 - - FOG0002733
OrthoInspector 1 1.000 - - oto97254
orthoMCL 1 0.900 - - OOG6_101530
Panther 1 1.100 - - LDO PTHR23402
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2169
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.