DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32147 and M04C9.2

DIOPT Version :9

Sequence 1:NP_730035.1 Gene:CG32147 / 251690 FlyBaseID:FBgn0047178 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_492489.2 Gene:M04C9.2 / 187439 WormBaseID:WBGene00010857 Length:248 Species:Caenorhabditis elegans


Alignment Length:235 Identity:58/235 - (24%)
Similarity:99/235 - (42%) Gaps:54/235 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IVVSGF-GPFLGHEAVNASWEAVKLLPEILTH--DGIEYDLEKRLVSVEYGAVDEAVAEIWKRQP 70
            :|::.| |.|   |.::.:..:| ::.|:|..  :.:.:.:.|  ..|.|..|.|.|.|:.::.|
 Worm    47 VVITAFDGQF---EDLDYNPSSV-VIDELLKEEIENVRFTVHK--FPVSYETVAEKVPELREKYP 105

  Fly    71 YLVIHVGVSGVAKCVYIEKLAYNHKFRRADNCDKKLANG------TCELPNNGHAN---VLKTEL 126
            ..|:|:....|...|..|:.|:      :|...||..||      |....|...|:   .||..:
 Worm   106 DEVLHLAAHSVKNRVLFEEKAF------SDGYVKKDVNGFVPEGNTISSENYEDADDRKSLKPFI 164

  Fly   127 DVDKIVAVVNENCA-D-------CVGPTQQPTHNDNLKSLSATKASKNVGDFLCGYIYLKSLDMD 183
            |.|.::..|.|.|. |       .||.:|:|              .::||    ||:|..||...
 Worm   165 DFDFLIEDVTEKCGLDGEKFGGLTVGKSQEP--------------GRSVG----GYLYYLSLRER 211

  Fly   184 RKRSLFVHVPPVDRPFSSVKTSEILFSIVEQCIQQVVAFD 223
            ...:|.:|:|    ||....|.|.:.:::.:.|:.:...|
 Worm   212 PINTLLIHIP----PFEGECTKEAVTNVIREAIKFITIND 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32147NP_730035.1 Peptidase_C15 7..222 CDD:238279 57/232 (25%)
M04C9.2NP_492489.2 Peptidase_C15 48..194 CDD:294167 40/157 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156511
Domainoid 1 1.000 56 1.000 Domainoid score I7322
eggNOG 1 0.900 - - E1_COG2039
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9793
Inparanoid 1 1.050 86 1.000 Inparanoid score I3726
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52915
OrthoDB 1 1.010 - - D1248044at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23402
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2169
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.870

Return to query results.
Submit another query.