DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32147 and M04C9.1

DIOPT Version :9

Sequence 1:NP_730035.1 Gene:CG32147 / 251690 FlyBaseID:FBgn0047178 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001122498.1 Gene:M04C9.1 / 187438 WormBaseID:WBGene00010856 Length:223 Species:Caenorhabditis elegans


Alignment Length:221 Identity:51/221 - (23%)
Similarity:98/221 - (44%) Gaps:36/221 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RKLIVVSGFGPFLGHE-AVNASWEAVKLLPEILTHDGIEYDLEKRLVSVE----YGAVDEAVAEI 65
            |:::::.|.. .:|.| :.||:..:..::.:|.:.   :|. :|.:..::    |..:.:.:.|:
 Worm    25 REVVMIKGIA-IVGFETSENATNPSNDVMEQICSE---QYS-DKMIFLIKFPLSYDPLKQKIDEL 84

  Fly    66 WKRQPYLVIHVGVSGVAKCVYIEKLAYNHKFRRADNCDKKLANG---TCELPNNGHANVLKTELD 127
            ::....:..|.....|...:|:||.|:...:.:.|. ...|..|   :||..:    |.|:|.:|
 Worm    85 FECPGVVAFHFETHLVKNTIYVEKKAFQSGYHQKDE-KGYLPEGNKVSCESVD----NTLETIID 144

  Fly   128 VDKIVAVVNENCADCVGPTQQPTHNDNLK--SLSATKASKNVGDFLCGYIYLKSLDMDRKRSLFV 190
            ...:|..|.|.|.           .|.:|  .|. .:.|::.|..:..|.|..||....|.|:|:
 Worm   145 CMDVVKKVTEKCG-----------LDGVKFGGLK-VEVSEDPGRSIGAYSYYLSLQKSTKNSIFI 197

  Fly   191 HVPPVDRPFSSVKTSEILFSIVEQCI 216
            |||    ||....|.|.:.::|::.|
 Worm   198 HVP----PFGGECTKEAVVNVVKEII 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32147NP_730035.1 Peptidase_C15 7..222 CDD:238279 50/220 (23%)
M04C9.1NP_001122498.1 PgaPase_1 13..173 CDD:148019 34/169 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156508
Domainoid 1 1.000 56 1.000 Domainoid score I7322
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9793
Inparanoid 1 1.050 86 1.000 Inparanoid score I3726
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1248044at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23402
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2169
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.000

Return to query results.
Submit another query.