DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32147 and F35F10.7

DIOPT Version :9

Sequence 1:NP_730035.1 Gene:CG32147 / 251690 FlyBaseID:FBgn0047178 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_503909.1 Gene:F35F10.7 / 185312 WormBaseID:WBGene00018057 Length:232 Species:Caenorhabditis elegans


Alignment Length:190 Identity:39/190 - (20%)
Similarity:78/190 - (41%) Gaps:28/190 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 AVKLLPEILTHDGIEYDLEKRLVSVEYGAVDEAVAEIWKRQPYLVIHVGVSGVAKCVYIEKLAYN 93
            ||.:..|:....|  |......:...|..||:.|.|:.|......||:....:...:.|.:.|::
 Worm    53 AVIVYEELAKSGG--YCCRPSKMEESYVKVDQVVQEMAKITSKCAIHLSSHALKNTIQIVRTAFS 115

  Fly    94 HKFRRADNCDKKLANGTCELPNNGHANVLKTELDVDKIVAVVNENCADCVGPTQQPTHNDN---- 154
            .::.:.|. |..:..|. |:..:|...|:||.::.:|:|..:||...:           |.    
 Worm   116 GEYTQNDK-DGNVPEGN-EVKFDGDETVMKTTVNCEKLVEDINEFMEE-----------DRQMYG 167

  Fly   155 -LKSLSATKASKNVGDFLCGYIYLKSLDMDRKRSLFVHVPPVDRPFSSVKTSEILFSIVE 213
             |:.....::.:|:.    ||.|...|......::.:.:||::    ...|.|::..::|
 Worm   168 ALEIQIMEESERNID----GYAYFSFLKFVPCGNIHLRIPPLE----GSCTKEVINEVIE 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32147NP_730035.1 Peptidase_C15 7..222 CDD:238279 39/190 (21%)
F35F10.7NP_503909.1 PgaPase_1 13..176 CDD:148019 29/137 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156509
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1248044at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23402
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.900

Return to query results.
Submit another query.