DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32147 and F35F10.6

DIOPT Version :9

Sequence 1:NP_730035.1 Gene:CG32147 / 251690 FlyBaseID:FBgn0047178 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_503910.2 Gene:F35F10.6 / 185311 WormBaseID:WBGene00018056 Length:220 Species:Caenorhabditis elegans


Alignment Length:175 Identity:36/175 - (20%)
Similarity:74/175 - (42%) Gaps:26/175 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 RLVSVE--YGAVDEAVAEIWKRQPYLVIHVGVSGVAKCVYIEKLAYNHKFRRADNCDKKLANGTC 111
            :|..:|  |..||:.|.||...|....||:....:...:.|.:.|:.:.:.:.|.      ||..
 Worm    60 KLFKMEESYINVDQVVQEIANIQSRYAIHLSSHSLKNTIQIVRTAFPNGYTQNDK------NGNV 118

  Fly   112 ELPN----NGHANVLKTELDVDKIVAVVNENCADCVGPTQQPTHNDNLKSLSATKASKNVGDFLC 172
            ...|    :|...|:||.:|.:::|..:.|...:     .:..:.: |:.....::.:|    |.
 Worm   119 PEGNKVKFDGDETVMKTTVDCEQLVKDIKEFMEE-----DRQKYGE-LEIQIIEESERN----LD 173

  Fly   173 GYIYLKSLDMDRKRSLFVHVPPVDRPFSSVKTSEILFSIVEQCIQ 217
            ||.|...|......::.:.:||:....    |.|::..::|:.::
 Worm   174 GYAYFSFLKFVPCGTIHLRIPPLKESC----TKEVINKVIERIMR 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32147NP_730035.1 Peptidase_C15 7..222 CDD:238279 36/175 (21%)
F35F10.6NP_503910.2 PgaPase_1 13..167 CDD:148019 25/118 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156515
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2039
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H9793
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1248044at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23402
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.