DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32147 and F16H6.7

DIOPT Version :9

Sequence 1:NP_730035.1 Gene:CG32147 / 251690 FlyBaseID:FBgn0047178 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_507562.3 Gene:F16H6.7 / 184594 WormBaseID:WBGene00008897 Length:185 Species:Caenorhabditis elegans


Alignment Length:114 Identity:25/114 - (21%)
Similarity:46/114 - (40%) Gaps:18/114 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 PEILTHDG-IEYDLEKRL---VSVEYGAVDEAVAEIWKRQPYLVIHVGVSGVAKCVYIEKLAYNH 94
            |.::..|. ::.|..|.|   :...||.|||..|::...:.:..||:........:.|.:.||::
 Worm    47 PAVIVFDELVKSDTSKYLSFKMEQSYGKVDEIAAKMVTEEIHFTIHLCSHSQKNVIEIFQSAYSN 111

  Fly    95 KFRRADNCDKKLANGTCELPNNGHANVLKTE------LDVDKIVAVVNE 137
            .:...|...|        :|..|......||      ::.:::...|||
 Worm   112 GYTEKDKKGK--------IPEGGKVKCAGTETGARSKVNCEEVAKEVNE 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32147NP_730035.1 Peptidase_C15 7..222 CDD:238279 25/114 (22%)
F16H6.7NP_507562.3 PgaPase_1 13..171 CDD:148019 25/114 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156512
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2039
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H9793
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1248044at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23402
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.900

Return to query results.
Submit another query.