DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32147 and F16H6.4

DIOPT Version :9

Sequence 1:NP_730035.1 Gene:CG32147 / 251690 FlyBaseID:FBgn0047178 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001300081.1 Gene:F16H6.4 / 184591 WormBaseID:WBGene00008894 Length:435 Species:Caenorhabditis elegans


Alignment Length:213 Identity:51/213 - (23%)
Similarity:84/213 - (39%) Gaps:51/213 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VVSGF-GPFLGHEAVNASWEAVKLLPEILTHDG----IEYDLEKRLVSVEYGAVDEAVAEIWKRQ 69
            |::.| .||.|    .:...||.:..|::..||    :.:.:|:     .|..|||...:|...:
 Worm    39 VITVFDAPFEG----KSPSPAVIVFDELVDSDGSSKYLNFKMEQ-----SYEKVDEIPEKIDAER 94

  Fly    70 PYLVIHVGVSGVAKCVYIEKLAYNHKFRRADNCDKKLANG--TCELPNNGHANVLKTELDVDKIV 132
            ....||:|.......:.|.:.||:..:...|...|....|  .|.....|    .:|:::.:.:|
 Worm    95 IRYAIHLGSHSQKNVLQIFQSAYSDGYTEEDKNGKVPVGGKVKCAETETG----FRTKINCENVV 155

  Fly   133 AVVNENCADCVGPTQQPTHNDN-------LKSLSATKASKNVGDFLCGYIYLKSLDMDRKRSLFV 190
            ..|||             :.|:       |:..:..||.:|    |.||||...|.....|:||:
 Worm   156 TAVNE-------------YMDSNREKFGELRIETLNKAERN----LDGYIYFSFLKQKPCRNLFI 203

  Fly   191 HVPPVDR-------PFSS 201
            .:||::.       |.||
 Worm   204 RIPPLEHEKKIATDPISS 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32147NP_730035.1 Peptidase_C15 7..222 CDD:238279 51/213 (24%)
F16H6.4NP_001300081.1 PgaPase_1 13..179 CDD:148019 34/165 (21%)
PgaPase_1 258..414 CDD:148019
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156514
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1248044at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23402
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.810

Return to query results.
Submit another query.