DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32147 and PGPEP1L

DIOPT Version :9

Sequence 1:NP_730035.1 Gene:CG32147 / 251690 FlyBaseID:FBgn0047178 Length:224 Species:Drosophila melanogaster
Sequence 2:XP_011519556.1 Gene:PGPEP1L / 145814 HGNCID:27080 Length:287 Species:Homo sapiens


Alignment Length:217 Identity:62/217 - (28%)
Similarity:99/217 - (45%) Gaps:24/217 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SDRKLIVVSGFGPFLGHEAVNASWEAVKLLPEILTHDGIEYDLEKRLVSVEYGAVDEAVAEIWK- 67
            |....:||:|||||..| .||:||||||.|.::...:.....|....:.|:|......|..||: 
Human    72 SQPSCVVVTGFGPFRQH-LVNSSWEAVKELSKLGLGNETVVQLRTLELPVDYREAKRRVTGIWED 135

  Fly    68 RQPYLVIHVGVSGVAKCVYIEKLAYNHKFRRADNCDKKLANGTCELPNNGHANVLKTELDVDKIV 132
            .||.||:|||:...||.:.:|:...|..:|.||........|.| ||  |..:||::.:.:..:.
Human   136 HQPQLVVHVGMDTAAKAIILEQSGKNQGYRDADIRSFWPEGGVC-LP--GSPDVLESGVCMKAVC 197

  Fly   133 AVVNENCADCVGPTQQPTHNDNLKSLSATKASKNVGDFLCGYIYLKSLDMDRKRSLFVHVPPVDR 197
            ..|.....|.:                   .|::.|.::|.|.|..||...:..:..:||||:.|
Human   198 KRVAVEGVDVI-------------------FSRDAGRYVCDYTYYLSLHHGKGCAALIHVPPLSR 243

  Fly   198 PFSSVKTSEILFSIVEQCIQQV 219
            ...:......|..|:::.:::|
Human   244 GLPASLLGRALRVIIQEMLEEV 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32147NP_730035.1 Peptidase_C15 7..222 CDD:238279 61/214 (29%)
PGPEP1LXP_011519556.1 Peptidase_C15 76..243 CDD:238279 57/189 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141482
Domainoid 1 1.000 76 1.000 Domainoid score I8971
eggNOG 1 0.900 - - E1_COG2039
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 106 1.000 Inparanoid score I4939
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1248044at2759
OrthoFinder 1 1.000 - - FOG0002733
OrthoInspector 1 1.000 - - otm41417
orthoMCL 1 0.900 - - OOG6_101530
Panther 1 1.100 - - O PTHR23402
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2169
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.760

Return to query results.
Submit another query.