DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32147 and pgpep1l

DIOPT Version :9

Sequence 1:NP_730035.1 Gene:CG32147 / 251690 FlyBaseID:FBgn0047178 Length:224 Species:Drosophila melanogaster
Sequence 2:XP_002933356.3 Gene:pgpep1l / 100497886 XenbaseID:XB-GENE-940208 Length:199 Species:Xenopus tropicalis


Alignment Length:217 Identity:59/217 - (27%)
Similarity:107/217 - (49%) Gaps:30/217 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SSDRKLIVVSGFGPFLGHEAVNASWEAVKLLPEILTHDGIEYDLEKRLVS--VEYGAVDEAVAEI 65
            :|:..|:.|:||||:..: .||:||||||.|.::    |:..|:|.:::.  |:|..|...|.:|
 Frog     2 ASNSNLVAVTGFGPYRNY-IVNSSWEAVKELSKL----GLGGDVELQIMELPVKYSEVMRKVCKI 61

  Fly    66 WKR-QPYLVIHVGVSGVAKCVYIEKLAYNHKFRRADNCDKKLANGTCELPNNGHANVLKTELDVD 129
            |.. :|.|.:|||::..:|.:.:|:...|..:...|........|.|.|..            .:
 Frog    62 WTDWRPLLSVHVGMASSSKAITLEQCGRNKGYMEKDLGGAHPHGGCCLLEG------------PE 114

  Fly   130 KIVAVVNENCADCVGPTQQPTHNDNLKSLSATKASKNVGDFLCGYIYLKSLDMDRKRSLFVHVPP 194
            :|.:|:|.... |        .|.:|..:... .|::.|.:||.|.|..||...:.|::|:||||
 Frog   115 RIESVINMKTV-C--------KNISLPGIDVI-FSRDAGRYLCEYAYYISLHYGQGRAVFIHVPP 169

  Fly   195 VDRPFSSVKTSEILFSIVEQCI 216
            :.:..::...::.|..|:::.:
 Frog   170 LTKALTAQGLAQALQHIIQEML 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32147NP_730035.1 Peptidase_C15 7..222 CDD:238279 58/213 (27%)
pgpep1lXP_002933356.3 Peptidase_C15 8..191 CDD:238279 57/209 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 72 1.000 Domainoid score I9180
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 103 1.000 Inparanoid score I4828
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1248044at2759
OrthoFinder 1 1.000 - - FOG0002733
OrthoInspector 1 1.000 - - otm48624
Panther 1 1.100 - - O PTHR23402
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2169
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.160

Return to query results.
Submit another query.