DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Casp1 and Drice

DIOPT Version :9

Sequence 1:NP_036894.3 Gene:Casp1 / 25166 RGDID:2274 Length:402 Species:Rattus norvegicus
Sequence 2:NP_524551.2 Gene:Drice / 43514 FlyBaseID:FBgn0019972 Length:339 Species:Drosophila melanogaster


Alignment Length:326 Identity:85/326 - (26%)
Similarity:139/326 - (42%) Gaps:52/326 - (15%)


- Green bases have known domain annotations that are detailed below.


  Rat    91 SGPSAETVFVTEDSKGGHPFSSETKEKLNKEGGAFPGPSGSLKFCPLEIAQKLWKENHSEIYPIM 155
            ||.:..:..|...|   ||:.|..   :.:....:..||.|.:    :...|:..:.|:..|. |
  Fly    35 SGGAGSSGLVAGSS---HPYGSGA---IGQLANGYSSPSSSYR----KNVAKMVTDRHAAEYN-M 88

  Rat   156 KTPTRTRLALIICNTDFQ--HLSRRVGADVDLREMKLLLQDLGYTVKVKENLTALEMTKELKEFA 218
            :...| .:|||..:..|:  .|..|.|.:||...:..:|:.|.:.|.|.::....::.:.: |:|
  Fly    89 RHKNR-GMALIFNHEHFEVPTLKSRAGTNVDCENLTRVLKQLDFEVTVYKDCRYKDILRTI-EYA 151

  Rat   219 ACPEHKTSDSTFLVFMSHGLQEGICGITYSNEVADILKVDTIFQMMNTLKCPSLKDKPKVIIIQA 283
            |...|..||...:..:|||..    |..|:.:..  .|:|.|:.......||||..|||:..|||
  Fly   152 ASQNHSDSDCILVAILSHGEM----GYIYAKDTQ--YKLDNIWSFFTANHCPSLAGKPKLFFIQA 210

  Rat   284 CRGEK--QGVVLLKDSVGNSEEGFLTDAIFEDDGIK----KAHIEKDFIAFCSSTPDNVSWRHPV 342
            |:|::  .||.:.:...             |.||..    |..:..||:...|:.|...|||:..
  Fly   211 CQGDRLDGGVTMQRSQT-------------ETDGDSSMSYKIPVHADFLIAYSTVPGFYSWRNTT 262

  Rat   343 QGSLFIESLIKHMKEYAWSCD----LEDIFRKVRFSFEQ--PDS-----RLQMP-TTERVTLTKR 395
            :||.|::||...:.......|    |..:.::|...||.  ||:     :.|:| .|..:|...|
  Fly   263 RGSWFMQSLCAELAANGKRLDILTLLTFVCQRVAVDFESCTPDTPEMHQQKQIPCITTMLTRILR 327

  Rat   396 F 396
            |
  Fly   328 F 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Casp1NP_036894.3 CARD_CASP1-like 6..87 CDD:260036
CASc 152..400 CDD:214521 73/265 (28%)
DriceNP_524551.2 CASc 86..330 CDD:214521 73/265 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10454
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.