DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Casp1 and Strica

DIOPT Version :9

Sequence 1:NP_036894.3 Gene:Casp1 / 25166 RGDID:2274 Length:402 Species:Rattus norvegicus
Sequence 2:NP_001260718.1 Gene:Strica / 35528 FlyBaseID:FBgn0033051 Length:527 Species:Drosophila melanogaster


Alignment Length:331 Identity:82/331 - (24%)
Similarity:141/331 - (42%) Gaps:75/331 - (22%)


- Green bases have known domain annotations that are detailed below.


  Rat    94 SAETVFVTEDSKGGHPFSSETKEK----LNKEGGAFP---------GPSGSLKFCPLEIAQKLWK 145
            |..::|.:...:...|.||....|    |...||..|         ...|::. ..|.|::....
  Fly   243 SISSIFKSAPKQVDKPLSSTATPKPFISLGSSGGTKPKVTAVAQSQDAQGTIS-TSLGISKSSLT 306

  Rat   146 ENHSEIYPIMKTPTRTRLALIICNTDFQHLSR-RVGADVDLREMKLLLQDLGYTVKVKENLTALE 209
            :|..:       |.|   ..|..:..|.:.:. |.|:..|::.::...:.|...|:|..:.|.:.
  Fly   307 KNKLK-------PAR---VYIFNHERFDNKNEFRKGSAQDVKVLRATFEQLKCKVEVITDATLVT 361

  Rat   210 MTK-----ELKEFAACPEHKTSDSTFLVFMSHGLQEGICGITYSNEVAD-----ILKVDTIFQMM 264
            :.|     :.|:|    |.|:  :..||.:|||        |..:::|.     .|..|.:|.: 
  Fly   362 IKKTVRMLQTKDF----EDKS--ALVLVILSHG--------TRHDQIAAKDDDYSLDDDVVFPI- 411

  Rat   265 NTLKCPSLKDKPKVIIIQACRGEKQGVVLLKDSVGNSEEGFLTDAIFEDDGIKKAHIEKDFIAFC 329
              |:..:||||||:|.:|||:|:.|        :|    ||:|||. :.:|      ..:.|..|
  Fly   412 --LRNRTLKDKPKLIFVQACKGDCQ--------LG----GFMTDAA-QPNG------SPNEILKC 455

  Rat   330 SSTPDN-VSWRHPVQGSLFIESLIKHMKEYAWSCDLEDIFRKVRFSFEQPDSRLQMPTTERVTLT 393
            .||.:. ||:| ...|:.||::|.:.:.....:.|::.|...||...:......|:|:... |||
  Fly   456 YSTYEGFVSFR-TEDGTPFIQTLCEALNRSGKTSDIDTIMMNVRQVVKMQSKDRQIPSVTS-TLT 518

  Rat   394 KRFYLF 399
            .: |:|
  Fly   519 SK-YVF 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Casp1NP_036894.3 CARD_CASP1-like 6..87 CDD:260036
CASc 152..400 CDD:214521 68/260 (26%)
StricaNP_001260718.1 CASc 311..523 CDD:294037 67/260 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.