DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32276 and AT1G27330

DIOPT Version :9

Sequence 1:NP_728830.1 Gene:CG32276 / 251645 FlyBaseID:FBgn0047135 Length:64 Species:Drosophila melanogaster
Sequence 2:NP_564277.1 Gene:AT1G27330 / 839622 AraportID:AT1G27330 Length:68 Species:Arabidopsis thaliana


Alignment Length:56 Identity:25/56 - (44%)
Similarity:38/56 - (67%) Gaps:3/56 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RVANEKASKY---VTMRGNVPKSSKTKEGQYPVGPWLLALFIFVVCGSAIFQIVQS 60
            |:|:.|..|:   :..||.||:::..|...|||||.||..|:|||.||::|||:::
plant     6 RLADRKIEKFDKNILKRGFVPETTTKKGKDYPVGPILLGFFVFVVIGSSLFQIIRT 61

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32276NP_728830.1 RAMP4 2..58 CDD:399547 24/52 (46%)
AT1G27330NP_564277.1 RAMP4 4..59 CDD:399547 24/52 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 52 1.000 Domainoid score I4313
eggNOG 1 0.900 - - E1_KOG3491
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 51 1.000 Inparanoid score I2623
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1605112at2759
OrthoFinder 1 1.000 - - FOG0002048
OrthoInspector 1 1.000 - - oto3024
orthoMCL 1 0.900 - - OOG6_103949
Panther 1 1.100 - - O PTHR15601
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.830

Return to query results.
Submit another query.