DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32276 and serp2

DIOPT Version :9

Sequence 1:NP_728830.1 Gene:CG32276 / 251645 FlyBaseID:FBgn0047135 Length:64 Species:Drosophila melanogaster
Sequence 2:NP_001165073.1 Gene:serp2 / 779835 XenbaseID:XB-GENE-954859 Length:65 Species:Xenopus tropicalis


Alignment Length:62 Identity:43/62 - (69%)
Similarity:52/62 - (83%) Gaps:0/62 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAPPQRMRVANEKASKYVTMRGNVPKSSKTKEGQYPVGPWLLALFIFVVCGSAIFQIVQSIR 62
            |...||:|:||||.||.:|.||||.|:.:.:|.:|||||||||||:|||||||||||:||||
 Frog     1 MVAKQRIRMANEKHSKNITQRGNVAKTLRPQEEKYPVGPWLLALFVFVVCGSAIFQIIQSIR 62

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32276NP_728830.1 RAMP4 2..58 CDD:399547 37/55 (67%)
serp2NP_001165073.1 RAMP4 2..58 CDD:399547 37/55 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 74 1.000 Domainoid score I8985
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5096
OMA 1 1.010 - - QHG48811
OrthoDB 1 1.010 - - D1605112at2759
OrthoFinder 1 1.000 - - FOG0002048
OrthoInspector 1 1.000 - - otm48736
Panther 1 1.100 - - O PTHR15601
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4137
SonicParanoid 1 1.000 - - X1516
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.110

Return to query results.
Submit another query.