DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32276 and Serp2

DIOPT Version :10

Sequence 1:NP_728830.1 Gene:CG32276 / 251645 FlyBaseID:FBgn0047135 Length:64 Species:Drosophila melanogaster
Sequence 2:NP_001381721.1 Gene:Serp2 / 498546 RGDID:1566076 Length:65 Species:Rattus norvegicus


Alignment Length:62 Identity:43/62 - (69%)
Similarity:52/62 - (83%) Gaps:0/62 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAPPQRMRVANEKASKYVTMRGNVPKSSKTKEGQYPVGPWLLALFIFVVCGSAIFQIVQSIR 62
            |...||:|:||||.||.:|.||||.|:.:.:|.:|||||||||||:|||||||||||:||||
  Rat     1 MVAKQRIRMANEKHSKNITQRGNVAKTLRPQEEKYPVGPWLLALFVFVVCGSAIFQIIQSIR 62

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32276NP_728830.1 RAMP4 2..58 CDD:461965 37/55 (67%)
Serp2NP_001381721.1 RAMP4 3..58 CDD:461965 37/54 (69%)

Return to query results.
Submit another query.