DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32276 and zgc:85858

DIOPT Version :9

Sequence 1:NP_728830.1 Gene:CG32276 / 251645 FlyBaseID:FBgn0047135 Length:64 Species:Drosophila melanogaster
Sequence 2:NP_998108.1 Gene:zgc:85858 / 405879 ZFINID:ZDB-GENE-040426-2333 Length:66 Species:Danio rerio


Alignment Length:63 Identity:42/63 - (66%)
Similarity:52/63 - (82%) Gaps:1/63 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAPPQRMRVANEKASKYVTMRGNVPKSSK-TKEGQYPVGPWLLALFIFVVCGSAIFQIVQSIR 62
            |:..|||:|||||.||.:|.||:|.|::: ..|.:.||||||||||:|||||||||||:||||
Zfish     1 MSAVQRMKVANEKHSKTITQRGHVQKTTRVVNEEKSPVGPWLLALFVFVVCGSAIFQIIQSIR 63

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32276NP_728830.1 RAMP4 2..58 CDD:399547 36/56 (64%)
zgc:85858NP_998108.1 RAMP4 2..59 CDD:399547 36/56 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583973
Domainoid 1 1.000 89 1.000 Domainoid score I7821
eggNOG 1 0.900 - - E1_KOG3491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5075
OMA 1 1.010 - - QHG48811
OrthoDB 1 1.010 - - D1605112at2759
OrthoFinder 1 1.000 - - FOG0002048
OrthoInspector 1 1.000 - - otm24568
orthoMCL 1 0.900 - - OOG6_103949
Panther 1 1.100 - - O PTHR15601
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1516
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.770

Return to query results.
Submit another query.