Sequence 1: | NP_728830.1 | Gene: | CG32276 / 251645 | FlyBaseID: | FBgn0047135 | Length: | 64 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_055260.1 | Gene: | SERP1 / 27230 | HGNCID: | 10759 | Length: | 66 | Species: | Homo sapiens |
Alignment Length: | 63 | Identity: | 43/63 - (68%) |
---|---|---|---|
Similarity: | 50/63 - (79%) | Gaps: | 1/63 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MAPPQRMRVANEKASKYVTMRGNVPKSSK-TKEGQYPVGPWLLALFIFVVCGSAIFQIVQSIR 62 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG32276 | NP_728830.1 | RAMP4 | 2..58 | CDD:399547 | 37/56 (66%) |
SERP1 | NP_055260.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..31 | 17/29 (59%) | |
RAMP4 | 2..59 | CDD:399547 | 37/56 (66%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165149834 | |
Domainoid | 1 | 1.000 | 89 | 1.000 | Domainoid score | I7851 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 1 | 1.000 | - | - | H8691 | |
Inparanoid | 1 | 1.050 | 92 | 1.000 | Inparanoid score | I5088 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 1 | 1.010 | - | - | QHG48811 | |
OrthoDB | 1 | 1.010 | - | - | D1605112at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0002048 | |
OrthoInspector | 1 | 1.000 | - | - | otm41523 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | LDO | PTHR15601 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R4137 |
SonicParanoid | 1 | 1.000 | - | - | X1516 | |
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 1 | 0.960 | - | - | ||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
15 | 15.000 |