DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32276 and SERP1

DIOPT Version :9

Sequence 1:NP_728830.1 Gene:CG32276 / 251645 FlyBaseID:FBgn0047135 Length:64 Species:Drosophila melanogaster
Sequence 2:NP_055260.1 Gene:SERP1 / 27230 HGNCID:10759 Length:66 Species:Homo sapiens


Alignment Length:63 Identity:43/63 - (68%)
Similarity:50/63 - (79%) Gaps:1/63 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAPPQRMRVANEKASKYVTMRGNVPKSSK-TKEGQYPVGPWLLALFIFVVCGSAIFQIVQSIR 62
            |...||:|:||||.||.:|.||||.|:|: ..|.:..|||||||||||||||||||||:||||
Human     1 MVAKQRIRMANEKHSKNITQRGNVAKTSRNAPEEKASVGPWLLALFIFVVCGSAIFQIIQSIR 63

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32276NP_728830.1 RAMP4 2..58 CDD:399547 37/56 (66%)
SERP1NP_055260.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31 17/29 (59%)
RAMP4 2..59 CDD:399547 37/56 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149834
Domainoid 1 1.000 89 1.000 Domainoid score I7851
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8691
Inparanoid 1 1.050 92 1.000 Inparanoid score I5088
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48811
OrthoDB 1 1.010 - - D1605112at2759
OrthoFinder 1 1.000 - - FOG0002048
OrthoInspector 1 1.000 - - otm41523
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15601
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4137
SonicParanoid 1 1.000 - - X1516
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1515.000

Return to query results.
Submit another query.