DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32276 and serp-1.1

DIOPT Version :10

Sequence 1:NP_728830.1 Gene:CG32276 / 251645 FlyBaseID:FBgn0047135 Length:64 Species:Drosophila melanogaster
Sequence 2:NP_001379193.1 Gene:serp-1.1 / 181669 WormBaseID:WBGene00010337 Length:65 Species:Caenorhabditis elegans


Alignment Length:62 Identity:35/62 - (56%)
Similarity:47/62 - (75%) Gaps:0/62 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAPPQRMRVANEKASKYVTMRGNVPKSSKTKEGQYPVGPWLLALFIFVVCGSAIFQIVQSIR 62
            |||.|||.:||::.||.|..||||.||.|..|.:||..|||:.||:|||||||:|:|::.::
 Worm     1 MAPKQRMTLANKQFSKNVNNRGNVAKSLKPAEDKYPAAPWLIGLFVFVVCGSAVFEIIRYVK 62

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32276NP_728830.1 RAMP4 2..58 CDD:461965 33/55 (60%)
serp-1.1NP_001379193.1 RAMP4 2..58 CDD:461965 33/55 (60%)

Return to query results.
Submit another query.