DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32276 and serp2

DIOPT Version :9

Sequence 1:NP_728830.1 Gene:CG32276 / 251645 FlyBaseID:FBgn0047135 Length:64 Species:Drosophila melanogaster
Sequence 2:NP_001289406.1 Gene:serp2 / 100319240 ZFINID:ZDB-GENE-081104-143 Length:65 Species:Danio rerio


Alignment Length:62 Identity:43/62 - (69%)
Similarity:52/62 - (83%) Gaps:0/62 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAPPQRMRVANEKASKYVTMRGNVPKSSKTKEGQYPVGPWLLALFIFVVCGSAIFQIVQSIR 62
            |...||:|:||||.||.:|.||||.|:.:.:|.:|||||||||||:|||||||||||:||||
Zfish     1 MVAKQRIRMANEKHSKNITQRGNVAKTLRPQEEKYPVGPWLLALFVFVVCGSAIFQIIQSIR 62

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32276NP_728830.1 RAMP4 2..58 CDD:399547 37/55 (67%)
serp2NP_001289406.1 RAMP4 2..58 CDD:399547 37/55 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583972
Domainoid 1 1.000 89 1.000 Domainoid score I7821
eggNOG 1 0.900 - - E1_KOG3491
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5075
OMA 1 1.010 - - QHG48811
OrthoDB 1 1.010 - - D1605112at2759
OrthoFinder 1 1.000 - - FOG0002048
OrthoInspector 1 1.000 - - otm24568
orthoMCL 1 0.900 - - OOG6_103949
Panther 1 1.100 - - O PTHR15601
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4137
SonicParanoid 1 1.000 - - X1516
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.