DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp19a1 and Cyp318a1

DIOPT Version :9

Sequence 1:NP_058781.2 Gene:Cyp19a1 / 25147 RGDID:2457 Length:503 Species:Rattus norvegicus
Sequence 2:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster


Alignment Length:481 Identity:101/481 - (20%)
Similarity:184/481 - (38%) Gaps:130/481 - (27%)


- Green bases have known domain annotations that are detailed below.


  Rat   122 LQCIGMHENGIIFNNNPSLWRT--VRPFFMKALTGPGLIRMVE-----VCVESIKQHLD------ 173
            |.||.:|.|.|:  ...|.:|.  .||  :..|.|..::..::     .||.:..:.||      
  Fly    47 LLCINLHPNSIL--EKVSQYRVHFQRP--LAVLVGTRVLLYIDDPAGMECVLNAPECLDKTFLQD 107

  Rat   174 ----RLG-----------------------------DVTDNSG-------------------YVD 186
                |.|                             ||.::.|                   :..
  Fly   108 GFFVRRGLLHARGQKWKLRRKQLNPAFSHNIVASFFDVFNSVGNQMVEQFQTQTNLHGQAVKFTA 172

  Rat   187 VVTLMRHIMLDTSNTLFLGIP-----LDESSIVKKIQGYFNAWQALLIKPNIFFKI------SWL 240
            ...|:...:|:.|....:|.|     ||::.|....:.........::||.:..::      ..|
  Fly   173 AEDLLSRAVLEVSCLTIMGTPTNFTQLDDAHIAHSYKRLLEISAVRVVKPWLQIRLLHRLLAPEL 237

  Rat   241 YRKYERSVKDLKDEIEILVEKK------RQKVSSAEKLEDCMDFATDLIFAER------RGDLTK 293
            |.:.::..|.|:|.:..:|..|      |..|...:..||..:.....||.|:      .|::|.
  Fly   238 YEESKKCAKLLEDFVGGIVRTKHRNWRLRDAVGGEKSGEDASNGWQRRIFIEQIFQLAANGEMTL 302

  Rat   294 ENVNQCILEMLIAAPDTMSVTLYVMLLLIA-EYPEVETAILKEIHTVVGD-RDIRIGDVQNLKVV 356
            |.:......|::.:.:|:|.::.:.||.:| ...:.:..:|.||..:|.| ..:.:..:|.|:.:
  Fly   303 EEIMDEAQSMVLVSFETVSNSIMLALLCLATNKGDCQRRLLAEIRALVPDVGQVGLEQLQQLRYL 367

  Rat   357 ENFINESLRYQPVVDLVMRRALEDDVIDGYP----VKKGTNIILNIGRMHRLEYFPKPN--EFTL 415
            :.|::||||....|.:.:|....|..:.|..    |.:.:.::|:...|.|.|.:...|  :|..
  Fly   368 DAFVSESLRLLATVPMNLRHVSRDFRLAGRQHETIVPQNSIVVLDTFNMQRDERWWGANARQFDP 432

  Rat   416 ENF----------------------EKNVPYRY-FQPFGFGPRSCAGKYIAMVMMKVVLVTLLKR 457
            :.|                      :::..:.| |.||..|.|||.|:...:.:|||.||.|:..
  Fly   433 QRFLDQEEEQLSKGHNDSGSGEKRRQRDRRHSYSFLPFSNGLRSCIGRRYGLFIMKVFLVKLITN 497

  Rat   458 FHVKT---LQK-RCIENMP---KNND 476
            |..::   |:| :.:||:.   ||.|
  Fly   498 FDFQSDFELEKLQFVENISLKFKNAD 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp19a1NP_058781.2 CYP19A1 72..485 CDD:410709 101/481 (21%)
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 94/459 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.