DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp17a1 and spo

DIOPT Version :9

Sequence 1:NP_036885.2 Gene:Cyp17a1 / 25146 RGDID:2456 Length:507 Species:Rattus norvegicus
Sequence 2:NP_001286943.1 Gene:spo / 38631 FlyBaseID:FBgn0003486 Length:543 Species:Drosophila melanogaster


Alignment Length:518 Identity:129/518 - (24%)
Similarity:225/518 - (43%) Gaps:73/518 - (14%)


- Green bases have known domain annotations that are detailed below.


  Rat    20 SKTPGAKLPRSLPSLPLVGSLPFLPR-RGHMHVNFFKLQEKYGPIYSLRLGTTTTVIIGHYQLAR 83
            ::.||   ||   ..|::|:|..|.| |......|..|.::||.||||..|.|..:::.:.:|.|
  Fly    53 TQAPG---PR---PWPIIGNLHLLDRYRDSPFAGFTALAQQYGDIYSLTFGHTRCLVVNNLELIR 111

  Rat    84 EVLIKKGKEFSGRPQMVTQSLL--SDQGKGVAFADAGSSWHLHRKLV--------FSTFSLFKDG 138
            |||.:.||..||||..:....|  .::...:|..|........|.|.        ||.|.:    
  Fly   112 EVLNQNGKVMSGRPDFIRYHKLFGGERSNSLALCDWSQLQQKRRNLARRHCSPREFSCFYM---- 172

  Rat   139 QKLEKLICQEA----KSLCDMMLAHDKESIDLSTPIFMSVTNIICAICFNISYEKKDPKLTAIKT 199
             |:.::.|:|.    :.|.:.::  ..|.|::...|..:..|:......::.::..|.....|..
  Fly   173 -KMSQIGCEEMEHWNRELGNQLV--PGEPINIKPLILKACANMFSQYMCSLRFDYDDVDFQQIVQ 234

  Rat   200 FTEGIVDATGDRNLVDIFPWLTIFPNKGL-EVIKGYAKVRNEVLTGIFEKCREKFD-SQSISSLT 262
            :.:.|.......:.:|..|||..|..:.| ::|...:.:|..::..|........| .:.....|
  Fly   235 YFDEIFWEINQGHPLDFLPWLYPFYQRHLNKIINWSSTIRGFIMERIIRHRELSVDLDEPDRDFT 299

  Rat   263 DILIQAKMNSDNNNSCEGRDPDVFSDRHILATVGDIFGAGIETTTTVLKWILAFLVHNPEVKKKI 327
            |.|:::.:          .|.|| |...|:..:.|..| |......::..:||::..|.::.::|
  Fly   300 DALLKSLL----------EDKDV-SRNTIIFMLEDFIG-GHSAVGNLVMLVLAYIAKNVDIGRRI 352

  Rat   328 QKEIDQYV-GFSRTPTFNDRSHLLMLEATIREVLRIRPVAPMLIPHKANVDSSIGEFTVPKDTHV 391
            |:|||..: ..:|:....|.:.:....|||.||||..  :..::||.|..|:.|..:.|.|.|.|
  Fly   353 QEEIDAIIEEENRSINLLDMNAMPYTMATIFEVLRYS--SSPIVPHVATEDTVISGYGVTKGTIV 415

  Rat   392 VVNLWALHHDENEWDQPDQFMPERFLDPTGSHLITPTQS----------------------YLPF 434
            .:|.:.|:..|..|..|.:|.|.|||:|:...  :|..|                      :|||
  Fly   416 FINNYVLNTSEKFWVNPKEFNPLRFLEPSKEQ--SPKNSKGSDSGIESDNEKLQLKRNIPHFLPF 478

  Rat   435 GAGPRSCIGEALARQELFVFTALLLQRFDLDVSDDKQLPRLEGDPKVVFL-IDPFKVKITVRQ 496
            ..|.|:|||:.|.|...|:....::||:::...:..   .::..|:.:.| .|.|.:.:|.|:
  Fly   479 SIGKRTCIGQNLVRGFGFLVVVNVMQRYNISSHNPS---TIKISPESLALPADCFPLVLTPRE 538

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp17a1NP_036885.2 CYP17A1 60..490 CDD:410766 115/469 (25%)
spoNP_001286943.1 p450 56..540 CDD:299894 129/515 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.