powered by:
Protein Alignment pen-2 and AT5G09310
DIOPT Version :9
Sequence 1: | NP_001286566.1 |
Gene: | pen-2 / 251430 |
FlyBaseID: | FBgn0053198 |
Length: | 101 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_196493.1 |
Gene: | AT5G09310 / 830790 |
AraportID: | AT5G09310 |
Length: | 146 |
Species: | Arabidopsis thaliana |
Alignment Length: | 67 |
Identity: | 22/67 - (32%) |
Similarity: | 39/67 - (58%) |
Gaps: | 3/67 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 LELCRKYFFAGFAFLPFVWAINVCWFFTEAFHKPPFSEQSQIKRYVIYSAVGTLFWLIVLTAWII 76
::..|:::..|||.||::|.:|..:|:....|...| .||:.||:.||:|...:..:|:||.:
plant 53 VDYARRFYKFGFALLPWLWFVNCFYFWPVLRHSRAF---PQIRNYVVRSAIGFSVFTALLSAWAL 114
Fly 77 IF 78
.|
plant 115 TF 116
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
pen-2 | NP_001286566.1 |
PEN-2 |
7..99 |
CDD:402042 |
22/67 (33%) |
AT5G09310 | NP_196493.1 |
PEN-2 |
48..137 |
CDD:402042 |
22/67 (33%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
1 |
1.000 |
48 |
1.000 |
Domainoid score |
I4505 |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3402 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1517974at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0006355 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_106556 |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR16318 |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
8 | 7.780 |
|
Return to query results.
Submit another query.