DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pen-2 and AT5G09310

DIOPT Version :9

Sequence 1:NP_001286566.1 Gene:pen-2 / 251430 FlyBaseID:FBgn0053198 Length:101 Species:Drosophila melanogaster
Sequence 2:NP_196493.1 Gene:AT5G09310 / 830790 AraportID:AT5G09310 Length:146 Species:Arabidopsis thaliana


Alignment Length:67 Identity:22/67 - (32%)
Similarity:39/67 - (58%) Gaps:3/67 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LELCRKYFFAGFAFLPFVWAINVCWFFTEAFHKPPFSEQSQIKRYVIYSAVGTLFWLIVLTAWII 76
            ::..|:::..|||.||::|.:|..:|:....|...|   .||:.||:.||:|...:..:|:||.:
plant    53 VDYARRFYKFGFALLPWLWFVNCFYFWPVLRHSRAF---PQIRNYVVRSAIGFSVFTALLSAWAL 114

  Fly    77 IF 78
            .|
plant   115 TF 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pen-2NP_001286566.1 PEN-2 7..99 CDD:402042 22/67 (33%)
AT5G09310NP_196493.1 PEN-2 48..137 CDD:402042 22/67 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 48 1.000 Domainoid score I4505
eggNOG 1 0.900 - - E1_KOG3402
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1517974at2759
OrthoFinder 1 1.000 - - FOG0006355
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_106556
Panther 1 1.100 - - LDO PTHR16318
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.780

Return to query results.
Submit another query.