DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pen-2 and psenen

DIOPT Version :9

Sequence 1:NP_001286566.1 Gene:pen-2 / 251430 FlyBaseID:FBgn0053198 Length:101 Species:Drosophila melanogaster
Sequence 2:NP_991139.1 Gene:psenen / 402810 ZFINID:ZDB-GENE-040218-1 Length:101 Species:Danio rerio


Alignment Length:101 Identity:57/101 - (56%)
Similarity:72/101 - (71%) Gaps:0/101 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDISKAPNPRKLELCRKYFFAGFAFLPFVWAINVCWFFTEAFHKPPFSEQSQIKRYVIYSAVGTL 65
            |::.:.||..||.|||:|:..|||||||:|.:|:.|||.|||.||.::||.|||.||..||:|.|
Zfish     1 MNLERIPNEEKLSLCRRYYLGGFAFLPFLWLVNILWFFKEAFLKPAYTEQPQIKSYVKKSALGLL 65

  Fly    66 FWLIVLTAWIIIFQTNRTAWGATADYMSFIIPLGSA 101
            .|:.|||.||.:||..|..||...||:||.||||:|
Zfish    66 LWVAVLTTWITVFQHFRAQWGEVGDYLSFTIPLGTA 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pen-2NP_001286566.1 PEN-2 7..99 CDD:402042 53/91 (58%)
psenenNP_991139.1 PEN-2 7..99 CDD:287253 53/91 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581488
Domainoid 1 1.000 125 1.000 Domainoid score I5430
eggNOG 1 0.900 - - E1_KOG3402
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11952
Inparanoid 1 1.050 133 1.000 Inparanoid score I4582
OMA 1 1.010 - - QHG55950
OrthoDB 1 1.010 - - D1517974at2759
OrthoFinder 1 1.000 - - FOG0006355
OrthoInspector 1 1.000 - - oto39546
orthoMCL 1 0.900 - - OOG6_106556
Panther 1 1.100 - - LDO PTHR16318
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2718
SonicParanoid 1 1.000 - - X5308
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.