DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pen-2 and Psenen

DIOPT Version :9

Sequence 1:NP_001286566.1 Gene:pen-2 / 251430 FlyBaseID:FBgn0053198 Length:101 Species:Drosophila melanogaster
Sequence 2:NP_001008764.1 Gene:Psenen / 292788 RGDID:1312037 Length:101 Species:Rattus norvegicus


Alignment Length:100 Identity:61/100 - (61%)
Similarity:73/100 - (73%) Gaps:0/100 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDISKAPNPRKLELCRKYFFAGFAFLPFVWAINVCWFFTEAFHKPPFSEQSQIKRYVIYSAVGTL 65
            |::.:..|..||.|||||:..|||||||:|.:|:.|||.|||..|.::||||||.||..||||.|
  Rat     1 MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFKEAFFAPAYTEQSQIKGYVWRSAVGFL 65

  Fly    66 FWLIVLTAWIIIFQTNRTAWGATADYMSFIIPLGS 100
            ||:||||.||.|||..|..|||..||:||.||||:
  Rat    66 FWVIVLTTWITIFQIYRPRWGALGDYLSFTIPLGT 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pen-2NP_001286566.1 PEN-2 7..99 CDD:402042 58/91 (64%)
PsenenNP_001008764.1 PEN-2 7..99 CDD:402042 58/91 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341483
Domainoid 1 1.000 133 1.000 Domainoid score I4958
eggNOG 1 0.900 - - E1_KOG3402
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11952
Inparanoid 1 1.050 137 1.000 Inparanoid score I4453
OMA 1 1.010 - - QHG55950
OrthoDB 1 1.010 - - D1517974at2759
OrthoFinder 1 1.000 - - FOG0006355
OrthoInspector 1 1.000 - - oto96124
orthoMCL 1 0.900 - - OOG6_106556
Panther 1 1.100 - - LDO PTHR16318
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5308
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.