DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zpg and inx-20

DIOPT Version :9

Sequence 1:NP_001261478.1 Gene:zpg / 251414 FlyBaseID:FBgn0024177 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001251235.1 Gene:inx-20 / 188818 WormBaseID:WBGene00002142 Length:483 Species:Caenorhabditis elegans


Alignment Length:386 Identity:98/386 - (25%)
Similarity:154/386 - (39%) Gaps:101/386 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LQFKSVHIYDAIF-TLHSKVTVALLLACTFLLSSKQYFGDPIQCFGDKDM-----DYVHAFCWIY 70
            |.|......|.|| .||...|...||....|:|.|.:.|.||:|:...:.     ||...:||..
 Worm    36 LSFLQPQADDDIFDRLHYYYTTTFLLLTAVLISLKMFGGRPIECWLPAEYKSSWEDYTEMYCWAR 100

  Fly    71 GAYVS----DNVTVTPLRNGAAQCRPDAVSKVVPPENRNY--ITYYQWVVLVLLLESFVFYMPAF 129
            ..||:    ||:             |:.|       ||.|  ::|||||...|:..:|.||.|..
 Worm   101 NTYVTAFEDDNL-------------PEVV-------NREYTMVSYYQWVPFFLVYVAFSFYAPCL 145

  Fly   130 LWKIW---EGGRLKHLCDDFHKMAVCKDKS------RT-HLRVLVNYFSSDYK------ETH--- 175
            :|:::   .|.|||.:      |....||:      || ::|.|..:.||.:|      |.|   
 Worm   146 IWRLFYDKSGIRLKDI------MGFANDKANVVPTQRTANIRGLSAHLSSVFKHRFRIGEKHPYH 204

  Fly   176 --------FRYFVSYVFCEILNLSISILNFLLLDVFFGGFWGRYRNALLSLYNGDYNQWNIITMA 232
                    .||:.||:....|.:....|..:|..::|       .:..|.|.:..|..:.|....
 Worm   205 HKVFRIFNVRYYESYLTYLYLAIKCLFLMNVLTQMYF-------MSRFLELDSHRYYGYGIFYDL 262

  Fly   233 V----------FPKCAKCEMYKGGPSGSSNIYDYLCLLPLNILNEKIFAFLWIWFILVAML---- 283
            :          ||....|:| :....|....:...|:|.:||..||||..||:|:.:::::    
 Worm   263 IMGKGWKESSNFPVVTYCDM-QIRILGHVQRHTVQCVLVINIFTEKIFFILWLWYTMLSLISFGS 326

  Fly   284 ------ISLKFLYRLATVLYPGMRLQLLRA---RARFMPKKHLQVALRNCSFGDWFVLMRV 335
                  .|:.|..|...:   ..||:|...   ::||  |:.|...:|:....|...::|:
 Worm   327 ILSWIFASIPFNQRRQFI---ARRLELADVNFEKSRF--KQELDEFVRDYIKIDGIFVLRM 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zpgNP_001261478.1 Innexin 21..353 CDD:279248 96/377 (25%)
inx-20NP_001251235.1 Innexin 45..403 CDD:279248 96/377 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 133 1.000 Domainoid score I3133
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I3152
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D323554at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4755
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11893
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X282
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.070

Return to query results.
Submit another query.