DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zpg and unc-9

DIOPT Version :9

Sequence 1:NP_001261478.1 Gene:zpg / 251414 FlyBaseID:FBgn0024177 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_741917.1 Gene:unc-9 / 181443 WormBaseID:WBGene00006749 Length:386 Species:Caenorhabditis elegans


Alignment Length:341 Identity:87/341 - (25%)
Similarity:142/341 - (41%) Gaps:80/341 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KYLQFKSVHIYDAIF-TLHSKVTVALLLACTFLLSSKQYFGDPIQC-----FGDKDMDYVHAFCW 68
            |.:||   |:.|.|. .|:...|.|::.....|:|:|||.|.||||     |.:....|...:||
 Worm    13 KSIQF---HVDDDIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVPATFTEPMEQYTENYCW 74

  Fly    69 IYGAYVSDNVTVTPLRNGAAQCRPDAVSKVVP-----PENRNYITYYQWVVLVLLLESFVFYMPA 128
            :...|      ..||.:            .:|     .|||. |.|||||..||.||:.:||:|.
 Worm    75 VQNTY------FLPLHD------------YIPHNYAERENRQ-IGYYQWVPFVLALEALLFYVPT 120

  Fly   129 FLWKI--WEGG-----RLKHLCDDFHKMAVCKDKSRTHLRVLVNYFSSDYKETHFRY-------- 178
            .:|::  |:.|     .::..||.  ::...:.::|....:..|.    .:..|.::        
 Worm   121 IVWRLLSWQSGIHVQSLVQMACDS--RLLDLESRNRALQTIATNV----EEALHVKHQVMSGNRL 179

  Fly   179 -FVSYVFC--------EILNLSISIL-------NFLLLDVFFGG---FWGRYRNALLSLYNGDYN 224
             .::.:.|        ..|.:|:.||       ...||:.|.|.   ::|  ...|..|.||  .
 Worm   180 KLLNLIICTRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFLGNRSKWYG--LQVLNDLMNG--R 240

  Fly   225 QWNIITMAVFPKCAKCEMYKGGPSGSSNIYDYLCLLPLNILNEKIFAFLWIWFILVAMLISLKFL 289
            :|.  ....||:...|: ::....|:.:.:...|:|.:|:.|||||.|||.|:.|:|........
 Worm   241 EWE--ESGHFPRVTLCD-FEVKVLGNVHRHTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLF 302

  Fly   290 YRLATVLYPGMRLQLL 305
            |.:...:.|..:|..:
 Worm   303 YWIYISVVPSRQLNFV 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zpgNP_001261478.1 Innexin 21..353 CDD:279248 83/330 (25%)
unc-9NP_741917.1 Innexin 22..374 CDD:395704 82/329 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 133 1.000 Domainoid score I3133
eggNOG 1 0.900 - - E1_2BWHM
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I3152
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D323554at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4755
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11893
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X282
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.