DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zpg and inx-3

DIOPT Version :9

Sequence 1:NP_001261478.1 Gene:zpg / 251414 FlyBaseID:FBgn0024177 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_509002.2 Gene:inx-3 / 180866 WormBaseID:WBGene00002125 Length:420 Species:Caenorhabditis elegans


Alignment Length:414 Identity:106/414 - (25%)
Similarity:173/414 - (41%) Gaps:93/414 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 FKSVHIYDAIFTLHSKVTVALLLA-CTFLLSSKQYFGDPIQCFGDKDM-----DYVHAFCWIYGA 72
            ||.....||:..| |.||.|.||| .:.::|.|||.|..|||:...:.     .|...:|:|   
 Worm    15 FKPKTFDDAVDRL-SYVTTATLLAFFSIMVSCKQYVGSAIQCWMPMEFKGGWEQYAEDYCFI--- 75

  Fly    73 YVSDNVTVTPLRNGAAQCRPDAVSKVVPPENRNYITYYQWVVLVLLLESFVFYMPAFLWKIWEGG 137
               .|....|.|:        .:...|....:..|.|||||.:||.:::|:||:|:::|     .
 Worm    76 ---QNTFFIPERS--------EIPGDVEDRQKAEIGYYQWVPIVLAIQAFMFYLPSWIW-----S 124

  Fly   138 RLKHLCD-DFHKM-----AVCKDKSRTH---LRVLVNY----FSSDYKETHFRYF---------- 179
            .|...|. ||..:     |:....|.|.   :..||::    ..:..|..:.|::          
 Worm   125 SLYKQCGLDFPSVISEAEALRSQDSETRTKGVNKLVDFIGDILDTRSKNEYGRFYCYRFGKGLGS 189

  Fly   180 ---VSYVFCEILNLSISILNFLLLDVFFGG---FWGRYRNALLSLYNGDYNQWNIITMAVFPKCA 238
               :.|:..:::.|:...:.|::|:.|.|.   .||.:..|  .||.|  .:|.  ...|||:..
 Worm   190 MTSMLYICIKLMYLANVFVQFIILNKFLGNETFLWGFHTFA--DLYAG--REWQ--DSGVFPRVT 248

  Fly   239 KCEMYKGGPSGSSNIYDYL--CLLPLNILNEKIFAFLWIWFILV---AMLISLKFLYRLATVLYP 298
            .|:.   .....:|::.|.  |:|.:|:.||||:.|:|.||:.|   ..:.:|..:|||:   :.
 Worm   249 LCDF---SVRKLANVHRYTVQCVLMINMFNEKIYLFIWFWFVFVLITTFINTLCTIYRLS---FD 307

  Fly   299 GMRLQLLRARA-----RFMPKKHLQVALRNCSF-GDWFVLMR---------VGNNISPELFRKLL 348
            ..|...:|:..     .|..:|.:..:..|... .|..:|||         |...|..|||:|..
 Worm   308 SSRHNYIRSLLSGPVNNFKDEKAMIASFANNGLKQDGVLLMRFIDDHAGAMVTKEICEELFKKHG 372

  Fly   349 EEL------YEAQSLIKIPPGADK 366
            |.|      :...|.....||.::
 Worm   373 ENLQHNRDFHHGHSTKSTSPGLEE 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zpgNP_001261478.1 Innexin 21..353 CDD:279248 101/392 (26%)
inx-3NP_509002.2 Innexin 21..370 CDD:279248 98/380 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 133 1.000 Domainoid score I3133
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I3152
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D323554at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4755
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11893
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X282
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.070

Return to query results.
Submit another query.