DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zpg and inx-14

DIOPT Version :9

Sequence 1:NP_001261478.1 Gene:zpg / 251414 FlyBaseID:FBgn0024177 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_492078.1 Gene:inx-14 / 172488 WormBaseID:WBGene00002136 Length:434 Species:Caenorhabditis elegans


Alignment Length:443 Identity:104/443 - (23%)
Similarity:170/443 - (38%) Gaps:137/443 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 FKSVHIYDAIFTLHSKVTVALLLACTFLLSSKQYFGDPIQCFGDKD-------MDYVHAFCWIYG 71
            ||:..:|:....|| ..||.||.....|..:||:||:||.|...|.       .||:|.||..||
 Worm    16 FKAAKLYEFYDRLH-LFTVYLLGFFVLLTGAKQHFGNPIDCMLPKQHDDLKSWRDYIHNFCLFYG 79

  Fly    72 AYVSDNVTVTPLRNGAAQ---CRPDAVSKVVPPENRNYITYYQWVVLVLLLESFVFYMPAFLWKI 133
            .:..|      :.||.::   ...||           .:.|||||......:...|.:|.:.|..
 Worm    80 TFRYD------VSNGTSEFGSYTEDA-----------SVNYYQWVPFFFAFQVCCFLLPFWCWAY 127

  Fly   134 WEGGRLKHLCDDFHKMAVCKD------------KSRTHLRVLVNYFSSDYKETHFR--------- 177
            .:  :|.::     .||...|            |::..:..:|||....:|   ||         
 Worm   128 MQ--KLIYI-----DMAFIVDYSGKINSEKTFEKTKEKVDRIVNYMHDHFK---FRRAHKMGYLS 182

  Fly   178 ------------------YFVSYVF------CEILNLSISILNFLLLDVF---------FGGFWG 209
                              :|::.|.      |:.|::......|.||..|         |..|..
 Worm   183 WITFNSAFPSVLYSLTKLFFITNVIIQVNLVCKFLDVDSWTWGFDLLGKFIHPTPRAPEFSSFSD 247

  Fly   210 RYRNALLSLYNGDYNQWNIITMAVFPKCAKCEMYKGGPSGSSNI-YDYLCLLPLNILNEKIFAFL 273
            :.|.|.: |.:|.||::.     .||....|| |:...|.|:.: :...|::|:|::|||||..|
 Worm   248 KQRFAAI-LTDGSYNRFQ-----YFPILVGCE-YQLQESVSNFVNHKAQCIIPMNVINEKIFIGL 305

  Fly   274 WIWFILVAMLI---SLKFLYRLAT------VLYPGMRLQLLRA---------RARFMPKKHLQVA 320
            :.|.:::..|.   ::|::.|:.:      ::|..::..|.|.         |..|: .|:|   
 Worm   306 YFWLLVLTALSVIGTVKWILRIKSKKLNEVMIYKLIKKSLEREPFDSNIHDHRYNFV-HKYL--- 366

  Fly   321 LRNCSFGDWFVLMRVGNN-------ISPELFRKL-----LEELYEAQSLIKIP 361
               |:.|...:...:..|       :...||:|.     ||.|..|.:|...|
 Worm   367 ---CADGILLIYFMMDTNGFLKTEEVIGALFKKYCSDAGLEPLQTAPTLTSSP 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zpgNP_001261478.1 Innexin 21..353 CDD:279248 98/426 (23%)
inx-14NP_492078.1 Innexin 24..397 CDD:279248 94/414 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D323554at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11893
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.