DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zpg and inx-13

DIOPT Version :9

Sequence 1:NP_001261478.1 Gene:zpg / 251414 FlyBaseID:FBgn0024177 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_491212.1 Gene:inx-13 / 171943 WormBaseID:WBGene00002135 Length:385 Species:Caenorhabditis elegans


Alignment Length:347 Identity:91/347 - (26%)
Similarity:142/347 - (40%) Gaps:69/347 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 DAIFTLHSKVTVALLLACTFLLSSKQYFGDPIQC-----FGDKDMDYVHAFCWIYGAYVSDNVTV 80
            |:|..|:...|..||:.....||:|||.|.||||     |......|...:|::...|.     :
 Worm    18 DSIDRLNYYWTPMLLVIFALTLSAKQYVGQPIQCWIPAQFTGAWEQYSENYCFVQNTYF-----I 77

  Fly    81 TPLRNGAAQCRPDAVSKVVPPENRN----YITYYQWVVLVLLLESFVFYMPAFLWKIW---EGGR 138
            :|             .|.:|....:    .|.|||||..:|.|::.:||:|:..|::.   .|..
 Worm    78 SP-------------DKYIPDSEIDREGAEIGYYQWVPFILGLQAILFYLPSLFWRLMNFNSGVA 129

  Fly   139 LKHLCDDFHKMAVCKDKSR--------THLRVLVNYFSSDYKETH-FRYFVS-----YVFCEILN 189
            ||.:.....|.....:|:|        .||...:...|...|.|. |.|..|     |:|.:.|.
 Worm   130 LKKMLFGAKKADRVDEKARNEAAKSTGAHLYESLTLQSRFAKYTSAFTYGGSYLTYLYLFVKFLY 194

  Fly   190 LSISILNFLLLDVFFG---GFWGRYRNALLSLYNGDYNQWNIITMAVFPKCAKCEMYKGGPSGSS 251
            |...:..|::|:.|.|   .|||  ...|..:.||  .:|.  ....||:...|: ::....|:.
 Worm   195 LVQIVFQFIILNNFLGTSYTFWG--LGILSDILNG--REWE--ESGHFPRVTMCD-FEVRVLGNK 252

  Fly   252 NIYDYLCLLPLNILNEKIFAFLWIWFILVAMLISLKFLYRLATVLYPGMRLQLLRARARFMPKKH 316
            :.:...|:|.:|:.|||::.|||.|.::|.:...|.        |....|..:.|:..:...|.:
 Worm   253 HRHTVQCVLMINMFNEKVYVFLWFWLVIVGVATFLN--------LVNWTRKLMFRSARKAHIKSY 309

  Fly   317 LQVA-------LRNCSFGDWFV 331
            ||:.       .||....|.||
 Worm   310 LQIEDNFSDDNSRNGQILDKFV 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zpgNP_001261478.1 Innexin 21..353 CDD:279248 91/347 (26%)
inx-13NP_491212.1 Innexin 17..366 CDD:279248 91/347 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 133 1.000 Domainoid score I3133
eggNOG 1 0.900 - - E1_2BWHM
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I3152
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4755
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11893
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X282
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.960

Return to query results.
Submit another query.