DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zpg and inx-19

DIOPT Version :9

Sequence 1:NP_001261478.1 Gene:zpg / 251414 FlyBaseID:FBgn0024177 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_490983.2 Gene:inx-19 / 171805 WormBaseID:WBGene00002141 Length:454 Species:Caenorhabditis elegans


Alignment Length:316 Identity:77/316 - (24%)
Similarity:136/316 - (43%) Gaps:71/316 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 DAIFTLHSKVTVALLLACTFLLSSKQYFGDPIQCF-----GDKDMDYVHAFCWIYGAY---VSDN 77
            ||:..|:...|..:|..|..::|:|||.|.||:|:     .:...:|:.::|||...|   :.:|
 Worm    38 DAVDRLNYYYTPLILAVCCLVISAKQYGGTPIECWVNPHSRESMEEYIESYCWIQNTYWIPMYEN 102

  Fly    78 VTVTPLRNGAAQCRPDAVSKVVPPENRNYITYYQWVVLVLLLESFVFYMPAFLWKI--WEGG--- 137
            |             ||..:    ......|.|||||..:|:.|:.:|.:|...|::  ::.|   
 Worm   103 V-------------PDDHT----AREEKQIGYYQWVPFILIAEALMFSLPCIFWRLCSFQSGLNI 150

  Fly   138 --RLKHLCDDFHKMAVCKDKSRTHLRVLVNYFSS-DYKETH-------------FRYFVS----- 181
              .:...||. ..:....|:.:....:..|:..: |.:..:             |..|:|     
 Worm   151 QTLINAACDG-QALLDASDRQKAVEAITTNFVDNLDLQSPNGRIRARGWIARIKFSRFLSGQCLS 214

  Fly   182 --YVFCEILNLSISILNFLLL-------DVFFGGFWGRYRNALLSLYNGDYNQWNIITMAVFPKC 237
              :.|.::|.....:..||:|       |..|.||     ..|..::.|  ..|.  ....||:.
 Worm   215 ILHSFTKLLYSMNVVAQFLILNACLKSSDFLFFGF-----QVLNDIWAG--RPWT--ETGHFPRV 270

  Fly   238 AKCEMYKGGPSGSSNIYDYLCLLPLNILNEKIFAFLWIWFILVAMLISLKFLYRLA 293
            ..|: ::.....:.|.|...|.|.:||:|||:|||||.|::::|::.:..|:|.:|
 Worm   271 TLCD-FEVRYLANLNRYTVQCALLINIINEKVFAFLWCWYMILAIITTCSFIYWIA 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zpgNP_001261478.1 Innexin 21..353 CDD:279248 77/316 (24%)
inx-19NP_490983.2 Innexin 37..414 CDD:279248 77/316 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 133 1.000 Domainoid score I3133
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I3152
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D323554at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4755
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11893
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X282
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.070

Return to query results.
Submit another query.