powered by:
Protein Alignment CG30270 and CG34234
DIOPT Version :9
Sequence 1: | NP_001356893.1 |
Gene: | CG30270 / 251324 |
FlyBaseID: | FBgn0061435 |
Length: | 146 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001097289.2 |
Gene: | CG34234 / 5740861 |
FlyBaseID: | FBgn0085263 |
Length: | 124 |
Species: | Drosophila melanogaster |
Alignment Length: | 73 |
Identity: | 33/73 - (45%) |
Similarity: | 50/73 - (68%) |
Gaps: | 3/73 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 67 PEMPMDLHMMHAPCDMD-TRGTQSYIFAFPNHCIWAFNNRYMSEGHFRIYKTYQLEGFFFGQYYE 130
|:...||.::||||:.| .|.|. |..:|.:|:..:.||:::|..:|:|:||..|||.|||:||
Fly 54 PDAKGDLKLLHAPCEFDLIRYTS--INHYPIYCLPVYTNRHVNEDWYRLYRTYDTEGFVFGQFYE 116
Fly 131 RLKRYEFE 138
||:|||.:
Fly 117 RLQRYELD 124
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45444801 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0019599 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.930 |
|
Return to query results.
Submit another query.