DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30270 and CG34234

DIOPT Version :9

Sequence 1:NP_001356893.1 Gene:CG30270 / 251324 FlyBaseID:FBgn0061435 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_001097289.2 Gene:CG34234 / 5740861 FlyBaseID:FBgn0085263 Length:124 Species:Drosophila melanogaster


Alignment Length:73 Identity:33/73 - (45%)
Similarity:50/73 - (68%) Gaps:3/73 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 PEMPMDLHMMHAPCDMD-TRGTQSYIFAFPNHCIWAFNNRYMSEGHFRIYKTYQLEGFFFGQYYE 130
            |:...||.::||||:.| .|.|.  |..:|.:|:..:.||:::|..:|:|:||..|||.|||:||
  Fly    54 PDAKGDLKLLHAPCEFDLIRYTS--INHYPIYCLPVYTNRHVNEDWYRLYRTYDTEGFVFGQFYE 116

  Fly   131 RLKRYEFE 138
            ||:|||.:
  Fly   117 RLQRYELD 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30270NP_001356893.1 DUF4768 58..143 CDD:318246 33/73 (45%)
CG34234NP_001097289.2 DUF4768 43..124 CDD:318246 33/71 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444801
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0019599
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.