DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FTL and Fer1HCH

DIOPT Version :9

Sequence 1:NP_000137.2 Gene:FTL / 2512 HGNCID:3999 Length:175 Species:Homo sapiens
Sequence 2:NP_001263104.1 Gene:Fer1HCH / 46415 FlyBaseID:FBgn0015222 Length:245 Species:Drosophila melanogaster


Alignment Length:177 Identity:48/177 - (27%)
Similarity:91/177 - (51%) Gaps:13/177 - (7%)


- Green bases have known domain annotations that are detailed below.


Human     4 QIRQNYSTDVEAAVNSLVNLY---LQASYTYLSLGFYFDRDDVALEGVSHFFRELAEEKREGYER 65
            :|.:::....:|.:..:.|..   :.|||.||::|.||.||.|...|.:..|.:.|:|:||...:
  Fly    69 EITKDWVDMKDACIKGMRNQIQEEINASYQYLAMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSK 133

Human    66 LLKMQNQRG----GRALFQDIKKPAEDEWGKTPDAMKAAMALEKKLNQALLDLHALGSARTDP-- 124
            |::..:.||    |.:...::...|:.||.....|:..|:.||.|:.:::..|  :.:....|  
  Fly   134 LVEYLSMRGQLTEGVSDLINVPTVAKQEWTDGAAALSDALDLEIKVTKSIRKL--IQTCENKPYN 196

Human   125 --HLCDFLETHFLDEEVKLIKKMGDHLTNLHRLGGPEAGLGEYLFER 169
              ||.|:|...:|:|::...:::...||.|.::......|||:||::
  Fly   197 HYHLVDYLTGVYLEEQLHGQRELAGKLTTLKKMMDTNGELGEFLFDK 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FTLNP_000137.2 Ferritin 10..169 CDD:153098 47/169 (28%)
Catalytic site for iron oxidation 54..61 2/6 (33%)
Fer1HCHNP_001263104.1 Euk_Ferritin 79..243 CDD:153114 47/165 (28%)
Ferritin 82..229 CDD:278632 41/148 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249457at2759
OrthoFinder 1 1.000 - - FOG0000169
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11431
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X152
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.