DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsd11b2 and CG8888

DIOPT Version :9

Sequence 1:NP_058777.1 Gene:Hsd11b2 / 25117 RGDID:2835 Length:400 Species:Rattus norvegicus
Sequence 2:NP_610724.1 Gene:CG8888 / 36293 FlyBaseID:FBgn0033679 Length:388 Species:Drosophila melanogaster


Alignment Length:372 Identity:105/372 - (28%)
Similarity:157/372 - (42%) Gaps:64/372 - (17%)


- Green bases have known domain annotations that are detailed below.


  Rat    29 RLGRPLL----AALA---LLAALDWLCQRLLPPPAALVVLAGAGWIALSRLARP-----PRLPVA 81
            ||..|.|    ||:.   ||.|||         .:::...|...|.||:.:...     .::..:
  Fly    39 RLFMPFLFCQAAAIVTSHLLHALD---------ISSISTFAVFVWFALATVGAVLFYHFVKVSAS 94

  Rat    82 TRAVLITGCDTGFGKETAKKLDAMGFTVLATVLDLNGP-----GALELRARCSPRLKLLQMDLTK 141
            .:.||||||:.......|||||.:||||.|   ..|.|     .|..|:...|.|:|||.:|:|.
  Fly    95 GKGVLITGCEAPLAWYLAKKLDDLGFTVYA---GFNTPIEESDEAKILKEVTSGRMKLLHLDVTS 156

  Rat   142 PEDISRVLEITKAHT--ASTGLWGLVNNAGLNMVVADVELSPVVTFRECMEVNFFGALELTKGLL 204
            .:.|.........|.  .:.|||.:|:.|.. :.:.::|..|....|:.:::|..|:..||:..|
  Fly   157 EKTILEAARYVSQHLPHGAEGLWSVVHCAHW-IALGELEWIPFAVLRKSLDLNLLGSARLTQIFL 220

  Rat   205 PLLRHSRGRIVTVGSPAGDMPYPCLAAYGTSKAAIALLMDTFSCELLPWGIKVSIIQPGCF---- 265
            ||:|.:.||:|.:.|....:|.|.......::||:.........|:...|:.||::..|.|    
  Fly   221 PLVRRAHGRVVFLTSGLNRVPSPVRGIQCATQAAVDCFAACLRQEMRTRGVDVSVVAAGEFAPGN 285

  Rat   266 ----KTEAVTNVNLWEKRKQLLLANLPRELLQAYGEDYIEHLHGQFLNSLRMALPDLSPVVDAII 326
                :||      |.::.|| :...|..|..:.|||||.|..........|.| .|:.|.:..:|
  Fly   286 GWLNETE------LRDQAKQ-MWNQLSSEQKKTYGEDYYEAAMTSVEKYSRQA-ADIQPTLRVLI 342

  Rat   327 DALLAAQPRSRYYTGRGLGLMYFIHHYLPGGLRRRFLQNFFISHLLP 373
            ||:....|.:|               |.|.....| ||.|...||.|
  Fly   343 DAVTRTFPMAR---------------YTPVTSSER-LQIFLAEHLAP 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsd11b2NP_058777.1 type2_17beta_HSD-like_SDR_c 83..363 CDD:187665 84/294 (29%)
adh_short 83..278 CDD:278532 62/209 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 378..400
CG8888NP_610724.1 NADB_Rossmann 96..380 CDD:304358 90/306 (29%)
adh_short 96..293 CDD:278532 61/206 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 120 1.000 Domainoid score I5601
eggNOG 1 0.900 - - E1_KOG1610
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D370032at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X110
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.