DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bru2 and WHI4

DIOPT Version :9

Sequence 1:NP_001036356.1 Gene:bru2 / 250811 FlyBaseID:FBgn0262475 Length:893 Species:Drosophila melanogaster
Sequence 2:NP_010057.1 Gene:WHI4 / 851302 SGDID:S000002383 Length:649 Species:Saccharomyces cerevisiae


Alignment Length:327 Identity:62/327 - (18%)
Similarity:105/327 - (32%) Gaps:115/327 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 VAHVANGNNSNSSAGSSSNSNSSSNNHSLYSNNNLNTGNNSQQQQQQQQQHPQILPVKYEYLENL 115
            |.|:.:..|.|:| |...::.|..:.|.|   |.:|....:|..||.....|..|.:..:     
Yeast   388 VPHIQSQPNLNNS-GVIHSATSLPHYHLL---NQINASTKTQSIQQSVSNVPSNLDLNLQ----- 443

  Fly   116 TSSGATSGAIAATTTFTGAAKSFHPY-LRPTGSGSNSNNSIAALSTTTAATAAKMSTTLFETLLH 179
            |.:|                   ||. ..|.||                            ::.:
Yeast   444 TENG-------------------HPQSSAPNGS----------------------------SIFN 461

  Fly   180 NQ-INSSPIALPAATAIAAISAAATAATATPGTAATAAAAAAAAPSTQLNSSINSRTSLGDQGGA 243
            || :|...:          :|...|:..:.....::.|:|:|.:.:.:.|.:.::..|..|    
Yeast   462 NQKVNQGFL----------VSEQDTSTISRQKECSSTASASAFSKNNETNVAGSTTISQAD---- 512

  Fly   244 IVVVTPAPPVAAPPTGGPNRNQSPTRDCSVKMELMESTSPDSIKDQPDADNIKMFVGQIPKTWDE 308
            :.::...||.|.|....|..|                               .::||.:|....|
Yeast   513 LSLLAKVPPPANPADQNPPCN-------------------------------TLYVGNLPPDATE 546

  Fly   309 TRLRQMFEQFGPVHTLNVLRDKVTSISRG-------CCFVTYYTRKAALRAQDALHNIKTLDGMH 366
            ..|||:|........|: .|:|:.|...|       .|||.:.....|.||...|:..:    :.
Yeast   547 QELRQLFSNQQGFRRLS-FRNKMNSHGHGNGHGHGPICFVEFEDVSFATRALAELYGSQ----LP 606

  Fly   367 HP 368
            ||
Yeast   607 HP 608

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bru2NP_001036356.1 RRM1_CELF1_2_Bruno 294..375 CDD:241075 22/82 (27%)
RRM2_Bruno_like 381..461 CDD:241080
RRM_SF 801..892 CDD:302621
WHI4NP_010057.1 RRM_scw1_like 531..624 CDD:409691 23/114 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343561
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.