DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bru2 and pAbp

DIOPT Version :9

Sequence 1:NP_001036356.1 Gene:bru2 / 250811 FlyBaseID:FBgn0262475 Length:893 Species:Drosophila melanogaster
Sequence 2:NP_476667.1 Gene:pAbp / 37070 FlyBaseID:FBgn0265297 Length:634 Species:Drosophila melanogaster


Alignment Length:464 Identity:113/464 - (24%)
Similarity:181/464 - (39%) Gaps:103/464 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   283 PDSIKDQPDADNIKMF----VGQIPKTWDETRLRQMFEQFGPVHTLNVLRDKVTSISRGCCFVTY 343
            |...:::...:..|:|    |....:.:|:.:|::.||.:|.:.:..|: .|....|:|..||.:
  Fly   167 PRKEREKELGEKAKLFTNVYVKNFTEDFDDEKLKEFFEPYGKITSYKVM-SKEDGKSKGFGFVAF 230

  Fly   344 YTRKAALRAQDALHNIKTLDG--MHHPIQMKPADSENRNERK----------------LFVGMLN 390
            .|.:||..|..||:.....:|  ::.....|.|:.:...:||                |:|..|:
  Fly   231 ETTEAAEAAVQALNGKDMGEGKSLYVARAQKKAERQQELKRKFEELKQKRHESVFGVNLYVKNLD 295

  Fly   391 KKYTEADVRQLFTGHGTIEECTVLRDQAGQSKGCAFVTFATKQNAIGAIKALHQSQTMEGCSAPL 455
            ....:..:|..|:.:|.|....|:.|:.|:|||..||.|.....|..|:..|  :..:.| |.||
  Fly   296 DTIDDDRLRIAFSPYGNITSAKVMTDEEGRSKGFGFVCFNAASEATCAVTEL--NGRVVG-SKPL 357

  Fly   456 VVKFADTQKEKDQK--------------KMQQIHAFCGINTPSGATAGAATPTINAATALIAAPP 506
            .|..|  |:::::|              :|||:..   |..|: |.:|...||:          |
  Fly   358 YVALA--QRKEERKAHLASQYMRHMTGMRMQQLGQ---IYQPN-AASGFFVPTL----------P 406

  Fly   507 SAGRTNPSMAAALAA-----VPQVQ--------QAGSAA------TAPTTLVPLNSTTALSASLT 552
            |..|...|..|....     ||||:        |||:||      ||........|..|.:....
  Fly   407 SNQRFFGSQVATQMRNTPRWVPQVRPPAAIQGVQAGAAAAGGFQGTAGAVPTQFRSAAAGARGAQ 471

  Fly   553 PNLLATNAAHQGAAAA-------AAYLGADPAAAAHLQL--YQQLHGYGLSPAHYLPGLNFHHPP 608
            |.:..|:||   ||||       |..:.....||.::|:  .|...|.....::|....|..:||
  Fly   472 PQVQGTHAA---AAAANNMRNTGARAITGQQTAAPNMQIPGAQIAGGAQQRTSNYKYTSNMRNPP 533

  Fly   609 ENSAHHSQHSP-GIGGASAASLSAAAATAASNPLGGAPPPTPT--------PTSSAGHAAGAGLL 664
            ....|.:|..| .:.|.::..|.|:.       |..|.|....        |.....||..||.:
  Fly   534 VPQLHQTQPIPQQLQGKNSEKLIASL-------LANAKPQEQKQILGERLYPMIEHMHANLAGKI 591

  Fly   665 AAPSMSMQN 673
            ....:.::|
  Fly   592 TGMLLEIEN 600

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bru2NP_001036356.1 RRM1_CELF1_2_Bruno 294..375 CDD:241075 22/86 (26%)
RRM2_Bruno_like 381..461 CDD:241080 26/95 (27%)
RRM_SF 801..892 CDD:302621
pAbpNP_476667.1 PABP-1234 2..625 CDD:130689 113/464 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.