DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bru2 and EEED8.12

DIOPT Version :9

Sequence 1:NP_001036356.1 Gene:bru2 / 250811 FlyBaseID:FBgn0262475 Length:893 Species:Drosophila melanogaster
Sequence 2:NP_495021.1 Gene:EEED8.12 / 173922 WormBaseID:WBGene00017140 Length:197 Species:Caenorhabditis elegans


Alignment Length:151 Identity:35/151 - (23%)
Similarity:64/151 - (42%) Gaps:26/151 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   373 PADSENR--NERKLFVGMLNKKYTEADVRQLFTGHGTIEECTVLRDQ-AGQSKGCAFVTF---AT 431
            |.:.|.:  :.:.:|:|.::...|..:|.:.|.|.|.|...|:.:|: ..:.|..|::.|   ::
 Worm    50 PTEEEQKAIDAKSVFIGNVDFNSTIEEVEEHFKGCGHIVRTTIPKDKFTKKQKNFAYIEFDDSSS 114

  Fly   432 KQNAIGAIKALHQSQTMEGCSAPLVVKFADTQKEKDQKKMQQIHAFCGINTPS-----GATAGA- 490
            .:||:....:|.:|:       |:||    |.|..:...|.  |...|.:..:     ||..|| 
 Worm   115 IENALVMNGSLFRSR-------PIVV----TAKRTNIPGMG--HGVRGSSRGTFGRGRGAARGAP 166

  Fly   491 -ATPTINAATALIAAPPSAGR 510
             ...|:......:..|...||
 Worm   167 GRQQTVVVKYVYVNGPNRGGR 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bru2NP_001036356.1 RRM1_CELF1_2_Bruno 294..375 CDD:241075 1/1 (100%)
RRM2_Bruno_like 381..461 CDD:241080 20/83 (24%)
RRM_SF 801..892 CDD:302621
EEED8.12NP_495021.1 RRM <11..>133 CDD:223796 20/89 (22%)
RRM_II_PABPs 62..134 CDD:240752 20/82 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158899
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.