DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bwa and YPC1

DIOPT Version :9

Sequence 1:NP_001260616.1 Gene:bwa / 250736 FlyBaseID:FBgn0045064 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_009742.1 Gene:YPC1 / 852481 SGDID:S000000387 Length:316 Species:Saccharomyces cerevisiae


Alignment Length:287 Identity:69/287 - (24%)
Similarity:106/287 - (36%) Gaps:104/287 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PG-----SSPVDWCEGNYLISSNIAEFVNTFSNFLFILLPPVLIMLFKEY-----GRFVTPGIHV 76
            ||     :|.:||||.||::|..|||:.||.:|.:|||  ..:...:..|     .||       
Yeast    14 PGVWGETTSTIDWCEENYVVSPYIAEWSNTLTNSVFIL--SAIYTTYSAYKNKLEKRF------- 69

  Fly    77 IWVLLI-----VVGLSSMYFHATLSLIGQLLDELAILWVFMAAFSLFYPKRYYPKFVKNDRKTFS 136
               |||     :||:.|..||.||....||||||.::      :::..|               :
Yeast    70 ---LLIGFGYGLVGVGSWLFHMTLKYRFQLLDELPMI------YAMCIP---------------T 110

  Fly   137 WLMLLSAIAA--TGLSWWK-PIVNAF---VLMFMSVPTMVMLYTELQRVSDQRVYRLGIRSTTVW 195
            |.::..|..|  .|.:..| |:....   |::.::|.|..:||...:.|...::. .|::...|.
Yeast   111 WSLVCEAKEALLNGDNHKKVPLFEQIFIGVIIGLAVTTASILYVIYKNVDIHQIL-FGVQIVVVA 174

  Fly   196 AVA-------------------------------VFCWINDRIFCEAWSSINFPYL--------- 220
            |.|                               ...|:.|..:|..|..:....|         
Yeast   175 ATAGSLTYRYVHDPLAKRNLKASMALGAILFLSGYISWLLDIHYCSFWVHVRRSILALPLGVLLE 239

  Fly   221 -HGFWHIFIFIAAYTVLVLFAYFYVES 246
             ||:|||...:.        .|||:.|
Yeast   240 PHGWWHILTGMG--------IYFYIVS 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bwaNP_001260616.1 Ceramidase 22..270 CDD:283521 69/287 (24%)
YPC1NP_009742.1 Ceramidase 15..285 CDD:399108 68/286 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345462
Domainoid 1 1.000 69 1.000 Domainoid score I2291
eggNOG 1 0.900 - - E1_KOG2329
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I1702
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46768
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2379
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.