DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bwa and ATCES1

DIOPT Version :9

Sequence 1:NP_001260616.1 Gene:bwa / 250736 FlyBaseID:FBgn0045064 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_567660.1 Gene:ATCES1 / 828328 AraportID:AT4G22330 Length:255 Species:Arabidopsis thaliana


Alignment Length:280 Identity:73/280 - (26%)
Similarity:121/280 - (43%) Gaps:58/280 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PGSSPVDWCEGNYLISSNIAEFVNTFSNFLFILLPPVLIMLFKEYGRFVTPGIHVIWVLLIVVGL 86
            |.:|.::.||.||..||.||||.||.||...|||  .||.|.....:.......::.:..:::.:
plant    11 PVTSTIECCEMNYAYSSYIAEFYNTISNVPGILL--ALIGLVNALRQRFEKRFSILHISNMILAI 73

  Fly    87 SSMYFHATLSLIGQLLDELAILW-VFMAAFSLFYPKRYYPKFVKNDRKTF-SWLMLLSAIAATGL 149
            .||.:||||..:.|..||..::| :.:..:.|:.|..:|       |.|. ::|.|..|..|   
plant    74 GSMLYHATLQHVQQQSDETPMVWEILLYMYILYSPDWHY-------RSTMPTFLFLYGAAFA--- 128

  Fly   150 SWWKPIVNAF------------VLMFMSVPTMVMLYTELQRVSDQRVYRLGIRSTTVWAVAV--- 199
                 ||:|:            :|..:.:|.|...|...:..:.:|:.:        |.||.   
plant   129 -----IVHAYLRFGIGFKVHYVILCLLCIPRMYKYYIHTEDTAAKRIAK--------WYVATILV 180

  Fly   200 --FCWINDRIFCEAWSS--INFPYLHGFWHIFIFIAAYTVLVLFAYFYVESELPQRQPLLKYW-P 259
              .||..||:||:..|.  :| |..|..||:|:...:|.......:...:.         :.| |
plant   181 GSICWFCDRVFCKTISQWPVN-PQGHALWHVFMSFNSYCANTFLMFCRAQQ---------RGWNP 235

  Fly   260 KNEFEFGI-PFISIRNPDSK 278
            |.::..|: |::.|..|.::
plant   236 KVKYFLGVLPYVKIEKPKTQ 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bwaNP_001260616.1 Ceramidase 22..270 CDD:283521 71/270 (26%)
ATCES1NP_567660.1 Ceramidase 7..247 CDD:399108 71/270 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 84 1.000 Domainoid score I2864
eggNOG 1 0.900 - - E1_KOG2329
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I2335
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D969354at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto2861
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4505
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.830

Return to query results.
Submit another query.