DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bwa and acer3

DIOPT Version :9

Sequence 1:NP_001260616.1 Gene:bwa / 250736 FlyBaseID:FBgn0045064 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001280621.1 Gene:acer3 / 555411 ZFINID:ZDB-GENE-091204-155 Length:267 Species:Danio rerio


Alignment Length:291 Identity:87/291 - (29%)
Similarity:133/291 - (45%) Gaps:71/291 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 RPG-----SSPVDWCEGNYLISSNIAEFVNTFSNFLFILLPPVLIMLFKEYGRFVT--PGIHV-- 76
            |||     :|.:||||.||::|..||||.||.|| |.::|||:       ||...|  .|:.|  
Zfish     7 RPGYWGTPTSTLDWCEENYVVSYYIAEFWNTVSN-LIMILPPI-------YGAIQTCRDGLEVRY 63

  Fly    77 IWVL--LIVVGLSSMYFHATLSLIGQLLDELAILW---VFMAAFSLFYPKRYYPKFVKNDRKT-- 134
            :|..  |..||:.|..||.||....||||||.:::   ||:  :.|:       :..|.:|..  
Zfish    64 VWSFLGLAAVGIGSWSFHMTLQYEMQLLDELPMIYSCCVFV--YCLY-------ECFKQERAVNY 119

  Fly   135 FSWLMLLS---AIAATGLSWWKPIVN--------AFVLMFMSVPTMVMLYTELQRVSDQRVYRLG 188
            ||.::||:   .::...|.|.:|:.:        || |:..||..:..:|..|:        .||
Zfish   120 FSIILLLTFSIIVSVIYLLWKEPVFHQVMYAVLVAF-LVIRSVFIVTWVYPWLR--------ALG 175

  Fly   189 IRSTTVWAVAVFCWINDRIFCEAWSSIN---------FPYLHGFWHIFIFIAAYTVLVLFAYFYV 244
            ..|.:|:.:....|..|.:.|::..|..         ...||.:|||...:.:|..::|      
Zfish   176 FTSLSVFLLGFVLWNIDNMMCDSLRSARQQLPPVVGAVTQLHAWWHILTGLGSYLHILL------ 234

  Fly   245 ESELPQRQPLLKYWPKNEFEFGI-PFISIRN 274
              .|..|...||:.||.:|..|: |.:.|.:
Zfish   235 --SLQIRSTYLKHRPKVKFLCGVWPMLHIES 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bwaNP_001260616.1 Ceramidase 22..270 CDD:283521 85/284 (30%)
acer3NP_001280621.1 Ceramidase 9..261 CDD:283521 84/285 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2329
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D969354at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2379
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.