DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bwa and Acer3

DIOPT Version :9

Sequence 1:NP_001260616.1 Gene:bwa / 250736 FlyBaseID:FBgn0045064 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_038957015.1 Gene:Acer3 / 499210 RGDID:1561254 Length:295 Species:Rattus norvegicus


Alignment Length:304 Identity:87/304 - (28%)
Similarity:129/304 - (42%) Gaps:91/304 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PGSSPVDWCEGNYLISSNIAEFV----------------------------NTFSNFLFILLPPV 58
            |.:|.:||||.||:::..:|||.                            ||.|| |.:::||:
  Rat    13 PTTSTLDWCEENYVVTLFVAEFCEWSLRRGARARAEGRRVENAEGEPGREGNTVSN-LIMIIPPI 76

  Fly    59 L--IMLFKE--YGRFVTPGIHVIWVLLIVVGLSSMYFHATLSLIGQLLDELAILW---VFM-AAF 115
            .  |..|::  ..|::     ..:|.|.|||:.|..||.||....||||||.:::   :|: ..|
  Rat    77 FGAIQGFRDRLEKRYI-----AAYVALTVVGMGSWCFHMTLKYEMQLLDELPMIYSCCIFVYCMF 136

  Fly   116 SLFYPK---RYYPKFVKNDRKTFSWLMLLSAIAAT-GLSWWKPIVN-------AFVLMFMSVPTM 169
            ..|..|   .|:..|.         |:|.|.|..| .|...:||.:       .|.|:..|:..:
  Rat   137 ECFKTKSSINYHLLFT---------LVLFSLIVTTIYLKVKEPIFHQVMYGMLVFALVLRSIYIV 192

  Fly   170 VMLYTELQRVSDQRVYRLGIRSTTVWAVAVFCWINDRIFCEAWSSINF-----PYL------HGF 223
            ..:|..|:        .||..|.||:.:....|..|.|||:  |..||     |.|      |.:
  Rat   193 TWVYPWLR--------GLGYTSLTVFLLGFLLWNVDNIFCD--SLRNFRKTVPPVLGVATQFHAW 247

  Fly   224 WHIFIFIAAYTVLVLFAYFYVESELPQRQPLLKYWPKNEFEFGI 267
            |||...:.:| :.:||:.:       .|...|:|.||.:|.|||
  Rat   248 WHILTGLGSY-LHILFSLY-------TRTLYLRYRPKVKFLFGI 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bwaNP_001260616.1 Ceramidase 22..270 CDD:283521 87/304 (29%)
Acer3XP_038957015.1 Ceramidase 9..287 CDD:399108 87/304 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2329
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D969354at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.