DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bwa and ACER2

DIOPT Version :9

Sequence 1:NP_001260616.1 Gene:bwa / 250736 FlyBaseID:FBgn0045064 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001010887.2 Gene:ACER2 / 340485 HGNCID:23675 Length:275 Species:Homo sapiens


Alignment Length:257 Identity:127/257 - (49%)
Similarity:178/257 - (69%) Gaps:1/257 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 WEHLRPGSSPVDWCEGNYLISSNIAEFVNTFSNFLFILLPPVLIMLFKEYGRFVTPGIHVIWVLL 81
            |:.|:.|||.|||||.||.|...||||.||.||.||.:|||:.:.||::|......||::||.||
Human     7 WDQLQAGSSEVDWCEDNYTIVPAIAEFYNTISNVLFFILPPICMCLFRQYATCFNSGIYLIWTLL 71

  Fly    82 IVVGLSSMYFHATLSLIGQLLDELAILWVFMAAFSLFYPKRYYPKFVKNDRKTFSWLMLLSAIAA 146
            :|||:.|:|||||||.:||:|||||:|||.|.|.::::|:||.||..:|||..|..::.:.:...
Human    72 VVVGIGSVYFHATLSFLGQMLDELAVLWVLMCALAMWFPRRYLPKIFRNDRGRFKVVVSVLSAVT 136

  Fly   147 TGLSWWKPIVNAFVLMFMSVPTMVMLYTELQRVSDQRVYRLGIRSTTVWAVAVFCWINDRIFCEA 211
            |.|::.||.:|...||.:.||...:|..||:|..:.||::||:.|...|.:|:||||:||.|||.
Human   137 TCLAFVKPAINNISLMTLGVPCTALLIAELKRCDNMRVFKLGLFSGLWWTLALFCWISDRAFCEL 201

  Fly   212 WSSINFPYLHGFWHIFIFIAAYTVLVLFAYFYVESELPQRQPLLKYWPKNEFEF-GIPFISI 272
            .||.||||||..|||.|.:|||...|.||||...||:|::.|::|:||..::.| |:|::|:
Human   202 LSSFNFPYLHCMWHILICLAAYLGCVCFAYFDAASEIPEQGPVIKFWPNEKWAFIGVPYVSL 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bwaNP_001260616.1 Ceramidase 22..270 CDD:283521 124/248 (50%)
ACER2NP_001010887.2 Required for proper localization to the Golgi apparatus. /evidence=ECO:0000269|PubMed:20089856 1..13 2/5 (40%)
Ceramidase 13..261 CDD:368648 124/247 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156579
Domainoid 1 1.000 266 1.000 Domainoid score I1896
eggNOG 1 0.900 - - E1_KOG2329
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H14986
Inparanoid 1 1.050 282 1.000 Inparanoid score I2890
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49319
OrthoDB 1 1.010 - - D467572at33208
OrthoFinder 1 1.000 - - FOG0003532
OrthoInspector 1 1.000 - - oto89713
orthoMCL 1 0.900 - - OOG6_108491
Panther 1 1.100 - - LDO PTHR46139
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2379
SonicParanoid 1 1.000 - - X4505
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.